- Travel Insurance
Mexico Tour Packages
Are you planning a Mexico Tour from Dubai? Our All-inclusive Mexico Tour Packages from Dubai is the best and cheapest way to explore Mexico and other places with your loved ones. Our Mexico special vacation package includes return air tickets, hotel accommodation, transfers, tours, etc. Go Kite is the trusted tour operator for Mexico Tour Packages from UAE for your loved ones.
Why visit Mexico? A tropical treasure trove and a destination that offers something for everyone. Vibrant Mexico welcomes travellers with great beaches, antique ruins, fascinating culture, cities with colonial architecture and great nightlife scenes and delicious cuisine .
If you have been searching for the best Mexico trip Package this holiday season, your search ends here. You have the choice of booking land packages alone or packages with flights. We will assist you in planning a perfect Mexico Tour from UAE with your preferred tours, activities, hotels, and more. Contact us today and plan the perfect vacation in Mexico.
Trip Itinerary
Day 01: arrive mexico.
Arrive Mexico meet & greet by rep get transfer to Hotel- On arrive check in overnight stay at Hotel.
DAY 02: FULL DAY MEXICO CITY TOUR
Breakfast at Hotel -Enjoy a panoramic drive around the city, seeing emblematic monuments such as the Angel of Independence and the Fountain of the Goddess Diana, visit the National Palace and the awe-inspiring cathedral and see much, much more.
Drive along the breathtaking 12km-long Paseo de Reforma, which is dotted with monuments to Mexican national figures and events, such as the Aztec emperor Cuauhtemoc, Christopher Columbus and the War of Independence. Continue towards Avenida Juarez, with its mix of historic and modern buildings, towards the stunning art nouveau masterpiece that is the Palace of Fine Arts. Admire the intricate beauty of the House of Tiles, an 18th century palace with a façade completely adorned with blue and white tiles.
Behold a series of famous landmarks such as the general post office and the Bank of Mexico on the way to the enormous Zocalo square with its enormous Mexican flag. Here you will visit the baroque National Palace, with its famous frescoes by renowned artist Diego Riera, and the magnificent Metropolitan Cathedral.
Continue the tour with a visit to artisan outlets and the monument to the revolution before heading to the historic Colonia Guerrero quavrter and the imposing skyscrapers of the Financial District. Finally, if you go for the option with Museum, explore the beautiful Chapultepec neighbourhood, still dominated by the former Imperial Palace, and visit the National Museum of Anthropology, where you can admire a priceless collection of Aztec, Olmec and Maya artefacts.
- Angel of Independence
- Diana the Huntress Fountain
- National Palace
- Metropolitan Cathedral
- Monument of Christopher Columbus
- Avenida Juárez
- Palace of Fine Arts
- House of Tiles
- Revolution Monument
- Chapultepec
- National Museum of Anthropology
Overnight at Hotel
DAY 03: FULL DAY PUEBLA AND CHOLULA TOUR
Breakfast at Hotel-An area characterised by a landscape dotted with volcanoes such as Popocatepetl and Iztacihuatl, see how the influence of talavera has shaped the architecture and handicrafts of Puebla. Talavera is a style of majolica pottery recognizable by a milky-white glaze. Authentic Talavera pottery may only come from the city of Puebla, Atlixco, Cholula, and Tecali thanks to both the quality of the natural clay and the traditional production process. A process originally imported from Spain and integrated with native motives and iconography with blue as the main colour.
During the walking tour we discover several gems. El Parían is an arts and crafts market located by the plaza, with permanent stalls and other vendors selling their goods on blankets spread on the floor. The Chapel of the Rosario, inside the Church of Santo Domingo, is full of symbolism, images and elements of New Spain’s Baroque. Finally the Cathedral that took 300 years to complete boasts the tallest bell towers in Mexico.
We also visit Cholula, whose pyramid is considered the largest in the country with each side about 400 metres long. Afterwards we continue to The Santa Maria de Tonantzintla Church where you can see the most surprising traditional work.
- The Chapel of the Rosario
- The Santa Maria de Tonantzintla Church
DAY 04: FULL DAY UNIVERISTY CITY TOUR AND FUN RIDE AT XOCHIMILCO
Breakfast at Hotel- On this tour of Ciudad Universitaria, or University City, you will not only come to appreciate its cultural and intellectual value to Mexico, but also how it is one of the city’s architectural wonders.
Your tour begins the moment you are picked up from your hotel and driven on a comfortable bus through the fascinating and lively streets of the federal district, or Distrito Federal – which give the D.F. to Mexico D.F. As you reach University City, contemplate the breath-taking expanses of lush campus terrain. This university’s lands are in fact so beautiful that they have become a popular weekend destination for walks and picnics. Spread over no less than 10,000 square kilometres, its countless paths, patios, routes and gardens guarantee a break from the hustle and bustle of Mexico City, notorious for its population density.
After soaking up the multicultural environment at the university, head off towards your next stop, the magnificent floating garden canals of Xochimilco. These stunning canals won’t only captivate you for their natural beauty; the manmade colourful decorations around them add a hint of magic to the entourage. Explore them aboard a traditional ‘trajinera’ while enjoying the happy-go-lucky twang of traditional Mexican music in the background. Without a shadow of a doubt, this is a great and enriching way of learning about and experiencing Mexican culture.
DAY 05: DEPARTURE
Breakfast at hotel check out and proceed to airport for your return Trip
01 March 2022 to 30 April 2023
Advance Confirmation
Want to speak to a travel expert?
Let our team of experts help you pick the best option for you!
You can unsubscribe at any time. Please see our Privacy Policy .
COUNTRYPICKERWESELECTEDHEADERMESSAGE
COUNTRYPICKERWESELECTEDMESSAGE click here
Choose your country and language
- The Americas
- The Middle East
- Asia & South Pacific
- All-Inclusive Offers
- Early Booking Offers
- Europe Offers
- Festive Markets
- Indian Ocean Offers
- Last Minute Holidays
- Luxury Holidays
- Maldives Offers
- Umrah Offers
- Vienna Offers
Featured Destinations
- Switzerland
- United Kingdom
- Philippines
- South Korea
- South Africa
Australasia
- New Zealand
Indian Ocean
- Czech Republic
- Antigua and Barbuda
- All-Inclusive Holidays
- Beach Holidays
- Business Class
- City Breaks
- Family Holidays
- Romantic Retreats
- Umrah Packages
- Costa Rica Tours
- Europe Tours
- Germany - Landscapes of Germany
- Jordan Tours
- Malaysia Tours
- South Africa Tours
- Sri Lanka Tours
- Tanzania - Best of Selous and Zanzibar
- Branch Location & Timings
- Pay My Balance
- Flight + Hotel
Search Holidays
- Manage My Booking
Mexico Holidays
Introduction, at a glance, when to visit, areas of mexico.
Ancient ruins meet modern day luxuries in Mexico, a holiday destination fit for any discerning traveller.
If you’re in the mood for a week of sunbathing and sipping cocktails, the Riviera Maya, on Mexico’s Yucatan Peninsula, is the place to be. It’s also located nearby eco parks and famous Mayan ruins – definitely worth exploring if you can tear yourself away from the golden sands.
Cancun is also home to a plethora of luxurious hotels, many of which boast indulgent spa facilities.
Capital: México City
Emirates Gateway: Mexico City International Airport (MEX)
Distance from México City Airport to City Centre: 11 kilometres - approx 35 mins drive
Time Zone: Mexico has four time zones. Mexico City, Cancun with Riviera Maya region UTC −6 hours in winter & UTC −5 hours in summer
Currency: Mexican Peso MXN (1 USD = 19.56 MXN)
Languages: Spanish is the official language. English is widely spoken in hotels and tourist areas
Getting Around: Taxis or Uber. While in México City you may also use the metro
Domestic Airlines: Aeromexico, Interjet and Volaris Airlines
Mexico's weather is enjoyable year-round, but October to May tend to be the most pleasant months to visit. Mexico has two principal travel seasons. High season begins around mid-December, peaks over New Year's and continues through Easter week. The rainy season begins in May and lasts until October.
Mexico City
The capital of the Mexican Republic portrays several expressions of its traditional roots evoking a native and colonial past, together with the most refined art and architectural expressions reflecting modernity and the potential future of a growing metropolis. The city offer its visitors a great deal of options including around 188 museums, 64 theatres, 15 cultural centres and 7 nearby archaeological zones, countless luxury hotels, sophisticated restaurants, great variety of shopping for all tastes and budgets and fabulous night life.
- Visit the Historic Centre of Mexico City. A UNESCO World Heritage Site and home to numerous historical buildings, museums and the Templo Mayor temple
- Spend a day at Chapultepec The world’s largest park within a city. visit the zoo and the Papalote Children’s Museum, perfect for the entire family
- Explore underwater world - the largest aquarium in Latin America with over 5,000 marine species
- The chic Polanco district offers the perfect destination for food and shopping lovers. Presidente Masaryk Avenue is full of elegant and high-end shops and restaurants
- Enjoy some one of the best art collections in Latin America with visits to the Soumaya Museum and Jumex Museum, both with stunning architectural design
- Discover the Palace of Fine Arts. The city’s premier arts institution and one of its architectural landmarks with amazing murals
- Experience old world charm at Coyoacán, an autonomous town outside the metropolis for several centuries. Walk through its peaceful cobblestone streets, colonial style mansions, flowering bougainvillea, ancient jacaranda trees, and picturesque churches.
A Caribbean paradise situated just over 2 hours flying from México City. It is known for its beaches, numerous resorts and energetic nightlife. It is composed of two distinct areas, which are the traditional downtown area and the glitzy hotel zone, a long beachfront strip of high-rise hotels, unabashed party scene and sophisticated seafood restaurants. The hotel zone is 15 minutes’ and downtown area is 20 minutes’ drive away from Cancún International Airport
For sports enthusiasts Cancún boasts great golf courses, incredible coral reefs for snorkelling and scuba diving, sport-fishing and jungle tours; for the sun worshippers, some of the most beautiful beaches in the world are in and around Cancún; for the culture buffs, Cancún was a part of the ancient Mayan civilization and is still considered the gateway to the Mayan World; and students flock here during the spring break period, making it one of Latin America’s key leisure destinations.
Resorts nestled around pristine beaches offer all-inclusive holidays and provide a true and sublime escape from the trappings of modern day life.
- Scuba diving or snorkelling in the amazing Underwater Museum of Art
- Enjoy the Theme Parks like: Xcaret, Xplor, Xoximilco, Xenses and Xel-Ha
- Explore the Biosphere Reserve of Sian Ka’an
- Take a jungle tour and discover the unique cenotes near Puerto Morelos
- Discover the legends and the hidden beauties of Isla Mujeres
- Learn about the Mayan civilization in the Museo Maya de Cancun and the El Rey Ruins
- Go on a shopping spree or Indulge yourself in a Spa treatment
Riviera Maya
120 km stretch of Caribbean coastline between Playa del Carmen and Tulum, on Mexico’s north-eastern Yucatán Peninsula. It offer its visitors, wonderful fine white sandy beaches, turquoise waters, archaeological sites, picturesque little towns, recreation centres, freshwater lagoons, underwater caves and cenotes, as well as ecological, and food and lodging options ranging from gleaming condos to five-star hotels, and all-inclusive resorts.
Experience regional cuisine prepared with the inherited Mayan recipes, travel back in time with a visit to the archaeological Mayan sites in Tulum, snorkel in the clear waters or just relax in your resort. Riviera Maya has exciting and diverse nightlife options with a wide variety of bars and nightclubs along the beach.
Cancun International Airport is the gateway to Riviera Maya and the time taken to travel from Cancun airport to its main towns are 30 minutes’ drive to Puerto Morelos, 40 minutes’ to Playa del Carmen and 120 minutes to Tulum
- Climb to top of Nohoch Mul Pyramid at Coba and enjoy the breath-taking view of the Mayan jungle, the lagoons, the cenotes and the white Mayan roads.
- Glide through the sky in zip-lines where you will fly over the jungle and splash into a cenote.
- Travel through the Mayan jungle, enjoy a private Photo Safari and capture hundreds of colourful birds in magnificent natural settings.
- Swim, snorkel or rest in the only archaeological site located by the sea...Tulum.
- Get into the Mexican culture and traditions and enjoy a great adventure in Xcaret Theme Park.
- Snorkel in the largest natural aquarium in the world Xel-Ha.
- Get in touch with one of the greatest biodiversity in the world on the Biosphere Reserve of Sian Ka’an, a World Heritage Site.
- Spend a memorable evening at Cirque Du Soleil, an award winning magical theatre with gourmet dinner experience.
Join the Emirates Holidays Community
Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.
We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.
Why Emirates Holidays?
- Personalised holidays
- Support at every step
- Get more for your money
- Fly Better with Emirates
- Enjoy rewards with Emirates Skywards
For more information, please click here
- Recent Hotels 0 You do not have any recently viewed hotels.
- Shortlist 0 Your hotel shortlist is empty!
- Recent Searches You do not have any recent searches
Please refresh this page
This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.
- Terms & Conditions
- Special Events
- instagram twitter facebook rss youtube
Destinations
- Cook Islands
- New Zealand
- Papua New Guinea
- USA (Hawaii)
Go Your Way...Tailor-made
- Beach/Islands Escapes
- Classics (Bestsellers)
- Go As You Please
- Private Experiences
- Self-Drives
- Snowbird/Long Stays
- Stays of Distinction
- Stopovers/City Breaks
- Tailor-made Travel Ideas
- Vacation Packages with Air
Other Ways to Go
- Active & Adventurous
- Cruises & Sailing
- Escorted Coach Touring
- Holidays of a Lifetime
- 18 to 30 Somethings
- Rail Travel Ideas
- Small Group Touring
- Speciality Groups & Events
- Family Vacations
- Luxury & Beyond
- Romance & Honeymoons
- Singles Friendly
- South Africa
- More Countries
- China & Tibet
- Indonesia (Bali)
- Chile & Easter Island
- Ecuador & Galapagos
- United States
- Bucket List Travel Ideas
- Multi Country Vacation Ideas
- United Arab Emirates (Dubai)
- Australia & South Pacific
- Africa & Middle East
- Central & South America
- US & Canada
- Idyllic Islands
- UK & Europe
- Arctic & Antarctica
- Presidents Message
- About Goway Travel
- Special Services & Expertise
- Company History
- Goway's Early Days
- The World of Travel in 1970
- Goway Timeline
- Our Website
- Awards & Recognition
Our Services
- Why Travel with Goway
- Destination Knowledge
- Group Service
- Repeat Passenger Privileges
- Make it Extra Special
- Your Holiday Your Way
- Value Added Extras
- 50+ Reasons Why to Go Downunder with Goway
Our Policies
- Booking Conditions
- Commitment to Accessibility
- Consumer Protection Plans
- Our Guarantee
- Privacy Policy
- Travel Insurance
News & Media
- Globetrotting Blog
Globetrotting Magazine
- Press Release Centre
Online Presentations
- Travel Expos
- Different Jobs at Goway
- Train to be an Expert
- Current Openings
- Why Work at Goway
- Employment FAQ's
- Testimonials
- World's Idyllic Islands
- You are here
- › Central & South America
- › Mexico
Mexico Vacation, Trip & Tour Packages
Mexico is the 14th largest country in the area in the world, has 10,000 kilometres/6000 miles of coastline and is ethnically made up of a mixture of Spanish and Indigenous peoples. Historically, it has grown from a melting pot of 300 years of many cultures including the Spanish Conquistadores and the advanced civilizations of the Mayan and Aztec Indians.
Why visit Mexico?
Mexico is a tourist-oriented very diverse destination offering many excellent beach resorts, amazing archeological sites, colourful colonial cities , sophisticated metropolises and natural beauty in its varied terrain, all to be enjoyed on a Mexico vacation. Whatever reason one has to visit the country on a Mexico vacation package, it is well worth combining pleasure and culture both provided in abundance in this destination. If the prime reason for a visit is sea, sun and sand, one is spoiled for choice. On the Pacific Ocean Coast, there is an array of excellent and attractive resorts such as Acapulco, a sophisticated and urban destination, the smaller resorts of Mazatlan and Manzanillo plus the resorts of the Baja Peninsula with its dramatic sea and landscapes, remote deserts and dormant volcanoes including the popular Cabo San Lucas. On the Atlantic Coast, in the Yucatan Peninsula are also a number of excellent resorts such as Cancun and Playa del Carmen. An advantage to these would be to explore the Peninsula laden with archaeological treasures and Colonial cities. The resort of Cozumel offers clear blue waters with wonderful coral reefs perfect for scuba diving or snorkelling on a Mexico vacation.
What are the top resorts to visit in Mexico? Pacific Coast
Puerto Vallarta was first put on the map by Hollywood stars Elizabeth Taylor and Richard Burton. It is a very picturesque resort. The town itself has cobblestone streets, white-walled houses and red-tiled roofs. In Puerto Vallarta, you can enjoy spectacular sunsets. Mazatlan is a mixture of culture and history within a modern destination. It is known worldwide as a sport fishing destination. Visitors can enjoy surfing, horseback riding, mountain biking, bird watching and golf in Mazatlan as well as its 25 kilometres/16 miles of golden beaches. Zihuatanejo retains the feel of an authentic Mexican small fishing town in a beautiful setting as the Sierra Madre mountains are close by. Popular activities include scuba diving, surfing, and deep-sea fishing. Located on the southern tip of Baja California, Los Cabos is a favourite getaway for Hollywood stars and celebrities who enjoy the gorgeous scenery and luxurious resorts. Only a few of Los Cabos' beaches are suitable for swimming, but there are plenty of other activities such as whale watching, sport fishing, and golfing.
Atlantic Coast
On a Mexico vacation, the Yucatan Peninsula contains a number of popular beach resorts which include Cancun , a fairly recently man-made resort dating back to 1970 before which it did not exist, Cozumel with its excellent scuba diving and snorkelling sites and Playa del Carmen , one of the fastest-growing resorts on the peninsula with luxury residential condominium buildings, restaurants, boutiques and entertainment venues.
What are the top cities or places to visit? Mexico City
The capital, Mexico City deserves several days to really make good use of the many attractions of North America’s largest city by population. The historic centre is a good starting point for Mexico vacations with the majestic Zocalo, the largest square in Latin America and the third largest in the world after Tien An Men Square, Beijing and Red Square, Moscow. Nearby is the Aztec Temple Mayor. The city boasts one of the largest parks in the world in the beautiful and lush Chapultepec Park, home to several museums and art galleries including the renowned National Museum of Anthropology with its amazing collection. It also houses a zoo, a castle and several lakes. In the near-lying suburbs are atmospheric San Angel with its cobblestone streets, upscale restaurants and boutiques, Coyoacan, an arts district and previously home to artists, Frida Kahlo and Diego Riviera plus Leon Trotsky and Xochimilco known as the Mexican Venice with its canals. Just outside Mexico City is the Teotihuacan Mayan archaeological site with its Pyramid of the Sun and also Taxco, a very pretty town known for its silverware and jewellery.
More information on Mexico City Vacations
Guadalajara
Guadalajara is the second largest city in the country with a colonial downtown. It is the home of Mariachi music and Tequila. The cathedral here built first in the 16th Century took 50 years to complete and rivals the one in Mexico City. The mural "The Assumption of the Blessed Virgin" by Bartolome Esteban Murillo must be seen. The Plaza de Los Mariachis is where you will find several mariachis bands who offer their music for a small fee.
Puebla, south-east of Mexico City, surrounded by volcanoes and snow-capped mountains, is a colonial city worth visiting on a Mexico vacation. It is known for its colonial architecture as well as being famous for its ceramics. The Catedral de Puebla is widely considered to be one of the country’s best with its tiled roof. The Museo Amparo has one of the finest collections of Mexican art in Latin America with everything from pre-Hispanic art to modern-day pieces.
Oaxaca is a city located about 480 kilometres/300 miles south of Mexico City. Oaxaca city’s pleasantly mild climate, due to its altitude of 1560 metres/5000 feet above sea level, is but one of many reasons to visit it on a Mexico vacation. Rich in history and culture, Oaxaca is a fascinating destination where you can appreciate ancient civilizations, colonial art and architecture and vibrant cultural traditions. It is especially known for its indigenous peoples and culture as well as its prehistoric ruins, baroque churches and monasteries and indigenous markets.
More information on Oaxaca Vacations
- Colonial Mexico
The Spanish Colonial era lasted around 300 years between 1521 and 1821. During this period, many cities and towns in Mexico inherited the style of architecture and ambience of the Spanish influence which can be experienced today on Mexico vacations. Some of the major Colonial cities are San Miguel de Allende, probably the most attractive colonial city in the country situated north of Mexico City on the “Colonial Route". The narrow cobblestone streets, leafy courtyards and well-preserved 17th and 18th Century buildings make this a pleasant city to spend time in. It is a town that has developed a following among artists. San Luis Potosi is an old silver mining city with its colonial inheritance of magnificent buildings, art and public spaces and Guanajuato is a gem named a World Heritage Site by UNESCO with its genuine Spanish Colonial look, style, and feel and atmosphere.
More about Colonial Mexico
Mayan Sites
Just outside Mexico City is the Teotihuacan Mayan archaeological site with its Pyramid of the Sun and also Taxco, a very pretty town known for its silverware and jewellery.
San Miguel de Allende is probably the most attractive colonial city in the country situated north of Mexico on the “Colonial Route". The narrow cobblestone streets, leafy courtyards and well-preserved 17 th and 18th-century buildings make this a pleasant city to spend time in.
Puebla, southeast of Mexico City is another colonial city worth visiting on a Mexico vacation. It is surrounded by volcanoes and snow-capped mountains and is known for its pottery and colourful ceramic tiles.
Guadalajara is a graceful city with a colonial downtown. It is the home of Mariachi music and Tequila. Oaxaca in the southern part of Mexico is a charming city full of culture with a rich and colourful history. Check out the indigenous market and the ruins of Monte Alban, a pre-Columbian archaeological site. In contrast, on a Mexico vacation, consider a train journey through the wild and exotic Copper Canyon in the Sierra Madre Mountains (an extension of the Rocky Mountains in the US).
Mexico Travel Information
At Goway we believe that a well-informed traveller is a safer traveller. With this in mind, we have compiled an easy-to-navigate travel information section dedicated to a Mexico vacation.
Learn about the history and culture of Mexico, the must-try food and drink, and what to pack in your suitcase. Read about Mexico's nature and wildlife , weather and geography, along with 'Country Quickfacts' compiled by our travel experts. Our globetrotting tips , as well as our visa and health information, will help ensure you're properly prepared for a safe and enjoyable trip. The only way you could possibly learn more is by embarking on your journey and discovering Mexico for yourself. Start exploring… book one of our Mexico vacations today!
"Globetrotting with Goway" blog articles
For some additional reading, the following articles are from our blog “ Globetrotting with Goway ”….. a great source of information for those people who are, or who want to be, world travellers!
How to Make the Best of Your Time in Mexico City on a Mexico Vacation
Explore the History and Culture of the Yucatan on a Mexico Vacation
Enjoy Strange and Unusual World Festivals on Various Vacation Packages (Part 1)
RECIPE: Oaxacan Stuffing
Extend Your Trip across Latin America
After your Mexico Tour , why not consider another of Goway's Latin America tours . These include a large selection of other exciting countries in Central and South America. We offer Chile vacation packages and Easter Island tours , Ecuador vacation packages which include Galapagos cruises , Peru vacation packages which include Machu Picchu tours and Brazil tours including Iguassu Falls tours among many others.
MODERATE | ESCORTED COACH: Discover the influences and legacies of the Spanish Colonial era in Mexico. Visit exceptionally beautiful towns and immerse yourself in history. You will be delighted at the colourful cities and towns offering extraordinary and remarkable sights including the Colonial-style buildings, plazas and avenues.
8 Trips Available
- Most Popular
- Price Range
- Duration Range
- Ideas for 18 to 30 Somethings
- Specialty Groups & Events
- Beach & Island Escapes
- Go as you Please
- Safaris Worldwide
- Snowbird Long Stays
- Vacation Packages with Airfare
- Luxury and Beyond
- Romance & Honeymoon
- Single Friendly
Great Mexico: Mexico City, Oaxaca, Palenque & More
Classic Mexico: Mexico City, San Cristóbal de las Casas, Campeche & More
Discover the Yucatan
Tierra Maya: Chicanná, Campeche, Mérida & More
Haciendas of the Yucatan
Mexico City in Depth
Mexico City: Day of the Dead
- Trip Finder
What our travelers say
Goway toolkit.
Need help planning your holiday? Our toolkit is a great place to get started.
Airfare Only
Looking for an airfare only? Ask the airfare experts at GowayAir.
Customise Your Trip
Let us customize a dream holiday for you. Your trip your way!
Get a Trip Quote
Need help in planning your perfect holiday? A FREE travel quote!
Need a Visa?
Do you need a Visa to enter? Let us assist with your travel documents.
The magazine for world travellers. Get your FREE subscription today.
eNewsletter Sign Up
Stay up to date with the latest travel info and destination deals!
Order a Brochure
Planning your next trip? Our brochures are loaded with great ideas.
Enjoy our online presentations from the comfort of your home.
- Cabo San Lucas
- Mexico City
- Playa del Carmen
- Mayan Riviera
- Yucatan Peninsula
Travel Information
- Introduction
- Things to do in Mexico
- Things to do in Mexico City
- Country Quickfacts
- Food and Drink
- Geography and Maps
- Nature and Wildlife
- Travel Tips, Visas & Health
- Best Time to Visit Mexico
- Mexico FAQs
- Mexico Destination & Travel Guide
- 10 Best Countries for History Buffs
- 10 Long Stays to Escape the North American Winter
- Why You Should Visit Merida, Mexico
Featured Tours
- Highlights of Downunder
- African Safaris
- China Odyssey
- A World in One Country
- Classic Australia
- Classic Thailand
- Essential New Zealand
- Rio, Iguassu Falls, & Buenos Aires
- Essential Peru
BC Reg. #833-0; TICO Reg. #1543989; CST #2016613-20
- Accessibility
Web Design by Atomic Motion Built by Bright Interactive
GOWAY DESTINATIONS
Vacations in Dubai
Search hundreds of travel sites at once for vacation package deals in dubai.
Let KAYAK do the searching
Save on your next vacation
Search and compare hundred of travel sites at once for vacation packages in Dubai
We’re completely free to use - No hidden charges or fees
Filter by free cancellation, free breakfast and more
Cheap Dubai package deals
Most popular dubai flight and hotel deals, all inclusive vacation packages to dubai, last minute vacation packages to dubai, search by stars, search by review score, search by board, search by price, search by freebies, when to book a vacation in dubai, tips for finding dubai package deals.
- There are loads of types of vacations in Dubai and the cost will depend on what type of trip you’re taking and for how long you’d like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $666; Family vacation $593; Romantic vacation $805; Luxury vacation $759; Budget vacation $462.
Why should you book a vacation package to Dubai?
With a good Dubai vacation package, you can experience this Persian Gulf emirate's famous 4X4 Desert Safaris and races, visit the Burj Khalifa, skydive over the world-famous Palm Jumeirah Island or take your kids to the Dubai Sky Polar pass or Dubai Atlantis Aquaven
When should you book a vacation package to Dubai?
The winter season in Dubai is the perfect time to take a vacation on the white sands of the Persian Gulf. From November to March it's the rainy season, which is the only cool period. The rains are short lived, however. Book your stay in advance to get the best Dubai package deals.
Where should you stay in Dubai during your vacation?
For any vacation type in dubai:.
Rove Downtown Dubai "is made for social media." The special hang out lounge features comfy sofas, a wall full of artworks and an eclectic collection of bric-a-brac. Many of the spacious rooms feature interconnecting doors perfect for families, 48-inch interactive TV screens, sofa beds for extra guests, a mini fridge, secure safe and in-room coffee and tea stations.
Located at the further end of Dubai Marina, Grosvenor House is a sophisticated twin tower hotel designed with marble floors, plush carpets, and mahogany furnishings. It's famous for offering the best Asian spa, heated pools, free spacious parking, a superb club lounge, airport transfers and shuttle bus services, and more.
For family vacations in Dubai:
The JA Jebel Ali Beach Hotel is a family-friendly resort located on the shores of the Persian Gulf. It offers a 9-hole golf course and horse riding. The breakfast-inclusive stays give your family access to temperature controlled swimming pools, shuttle bus services, and airport transportation.
Popularly known as the "House By The Sea," the Beit Al Bahar stand-alone villas offer complete privacy for your family. The hotel offers bed and breakfast, shuttle bus services, dry cleaning services, WiFi and room service, and is located in Jumeirah St next to the Wild Wadi Waterpark.
For romantic vacations in Dubai:
Located at the entrance to Jumeirah Island, the FIVE Palm Jumeirah Dubai Hotel is the perfect hideout for couples who want to reignite their passion and create their own epic stories at the beach while sharing inspiring moments. The hotel has a contemporary architectural design, has shuttle bus services, airport transfers, hot tub and air conditioning in all rooms, as well as plenty of parking space.
Atlantis, the Palm Hotel is a gem of sheer beauty located off Crescent Road. Atlantis provides breakfast, airport transportation, and dry cleaning services. The award-winning chef restaurants, aquarium and waterpark, and the Ocean Deluxe rooms are a must experience for couples.
For luxury vacations in Dubai:
With rotating beds that have a view of the city, the Burj Al Arab is the most luxurious hotel in Dubai. The opulent interiors are designed with towering golden pillars and stairs made of marble and gold. The hotel's Dubai travel package gives you the opportunity to arrive by helicopter, experience VIP services and have a 24-hour private butler.
The one and only Palm Dubai offers peace and tranquility in Dubai's breathtaking western portion of the Palm. Enjoy the bed and breakfast, Moorish and Andalusian design terraces and balconies or a suite with a private plunge pool.
For budget vacations in Dubai:
City Max Hotel Bur Dubai offers value for money comfort with breakfast, in-room refrigerators, access to an outdoor pool and free parking included in its Dubai vacation packages
Located a few meters from Dubai Creek, the 4-acre Arabian Park Hotel offers free and ample parking, an outdoor pool, bar/lounge, quiet surroundings, a shuttle bus service, and transport to and from the airport.
Where to stay in Dubai
Dubai vacation information, other popular package vacation destinations.
- Boston package vacations
- Bermuda package vacations
- Saint Lucia package vacations
- San José del Cabo package vacations
- Phoenix package vacations
- Atlanta package vacations
- Dublin package vacations
- Saint Thomas Island package vacations
- Belize package vacations
- Nashville package vacations
Mexico Tours & Trips
Peel back the lucha libre mask and you’ll find a patchwork of cultures and customs mixed into one flavor-filled country.
The gregarious locals are just as likely to pull you up for a dance at one of Mexico City ’s hip-shaking salsa clubs as they are to show you the way to one of the country’s many ancient ruins , all with a casual ‘hola’ and an inviting smile. While our tours get you up close with locals, they also show you the best sights from on and off the gringo trail. You can party until dawn in Playa del Carmen , eat your way into a food coma in colorful Oaxaca , or, best of all, kick back with a horchata in the lazy seaside port of Merida .
Our Mexico trips
Let's create an exclusive trip for your group.
Mexico tour reviews
Filter by rating
Central America Encompassed
Mexico Real Food Adventure
Premium Mexico Yucatan Highlights
Costa Rica or Mexico: Which country to check off next?
Machu Picchu or Chichen Itza? Which historical site should you visit?
Bueno, Bonito & Barato: What I learned on Intrepid’s Mexico food tour
10 awesome places to go for your 21st birthday
9 ways to make meaningful cultural connections through food in 2023
Finding Mexico’s hidden gems on a Tailor-Made tour with Fat Girls Traveling
15 photos that prove Mexico is the most colourful country on earth
The top 7 destinations for travel in February 2024
Mexico at a glance
Capital city.
Mexico City (population 8.7 million)
129.9 million
(GMT-06:00) Guadalajara, Mexico City, Monterrey - New
CALLING CODE
Electricity.
Type A (North American/Japanese 2-pin) Type B (American 3-pin)
Learn more about Mexico
Best time to visit mexico.
Mexico is generally most pleasant between September and June in the cool, dry season. July and August can be very hot and humid, but perfect for swimming, snorkeling, and lazing on the beach. These are, however, the busiest months for travel as this is the time of the North American school holidays. Highland areas such as Chiapas and Oaxaca tend to be cooler year-round, with cold nights.
Read more about the best time to visit Mexico
Culture and customs
Mexico lays claim to one of the richest and most historic cultures in the world. Characterized by strong regional identity, locals are affiliated directly to the region they hail from with each region having its own unique customs, cuisine and even language dialect. Despite this, national identity is still strong with all Mexicans sharing common bonds over their love of sport, dance, food and religion. With most of the country belonging to the Roman Catholic religion, religious festivals and celebrations are plentiful in Mexico. Parades, street fairs and parties held in honor of local saints are commonplace, and offer travelers the chance to witness the customs and rituals of this vibrant culture.
Eating and drinking
One of Mexico's biggest draws is its food and drink. From Oaxaca's indigenous staples to the sizzling street food of Mexico City, there's almost too much choice for the hungry traveler. By the end of your Mexico tour, you'll know your tacos from your tamales, your enchiladas from your elote and your tequila from your mezcal.
Eat your way through this vibrant country on our 9 day Mexico Real Food Adventure.
Read what to eat in Mexico
Read what to drink in Mexico
Geography and environment
Mexico shares land borders with the United States , Belize and Guatemala , and has an extensive coastline that runs along the Gulf of Mexico, the Pacific Ocean and the Caribbean Sea.
Featuring a wide variety of natural environments, Mexico is home to tracts of tropical rainforests, vast areas of low-lying plains and deserts, volcanic mountains and temperate beaches and lagoons.
Mexico's capital and major cities are typically built up, busy and lively – with a vast network of public transport, highways and roads. Rural areas, on the other hand, are distinctly less developed, with small-scale housing, unsealed roads and rustic farms.
History and government
Early history.
People have been living in Mexico for more than 13,000 years. Mesoamericans occupied the area early on, with archaeological evidence pointing towards Mesoamericans leading a hunter-gatherer existence. Maize farming is thought to have become commonplace by 1500 BC, which led to the farming of other commodities as well. A variety of cultures contributed to the early history of Mexico, with the Olmec, Toltec, Maya, Teotihuacan and Aztecs all bringing unique cultural, religious and artistic styles to the region, with the Mayan and Aztec Empires having the greatest (and most enduring) impact on the region.
Mayan society can be traced back to 300 BC, while the Aztecs enjoyed prosperity from 1325 to around 1521 AD. Many ancient ruins and constructions from these periods are still standing all throughout Mexico and can be visited and viewed today. By the 16th century, the Spanish had arrived in Mexico and what followed was a period of colonialism that lasted nearly 300 years.
During this time, Mexico was seen as a part of ‘New Spain’ along with Cuba and Puerto Rico. This was not a particularly good time for Mexicans who (under colonial law) were generally not allowed to travel outside of Mexico and were denied access to education. Mexico achieved independence from the Spaniards after the War of Independence (1810-1821) but peace was short-lived as two decades later the Mexican-American War brought more confrontation and armed conflict to parts of Mexico.
Recent history
Mexico’s Revolution of 1910 - 1921 was a period of instability, marked by political turmoil and bloodshed. More recently, Mexico has enjoyed an economic resurgence after decades of economic hardship, which lasted from the 1970s to the mid-1990s. The earthquake of 1985 didn’t help matters, with wide-scale damage and loss of life compounding the economic problems and political uncertainty of Mexico. Currently, Mexico is benefiting from a period of improved economic conditions, although the gap between the wages earned by Mexicans and their northern neighbors continues to widen. Mexico is now operating in a free market economy and the growth of tourism, agriculture and industry has ensured an improved economy for the country, although financial inequality still exists within.
Memorable moments of Mexico
1. ramble among the ruins.
A visit to the famed ruins of Chichen Itza reveals history, ancient architecture, and wildlife in equal measure. Walk through the complex and hear jungle animal calls as colorful birds fly among the canopy. This is a stirring experience to treasure.
2. Bittersweet bites
The cult of chocolate is well and truly alive in Oaxaca! The flavors here are simply phenomenal and unlike mass-produced chocolate in the Western world. Spiced with chili, cinnamon and cloves, you won’t soon forget the taste of Oaxacan chocolate.
3. Sunshine and snorkeling
Mexico’s Caribbean coastline showcases expanses of clear blue water, white sand beaches, vibrant reefs and plenty of sunshine. Snorkeling over colorful fish and sun-lit coral is simply unforgettable.
4. Mountain majesty
The cooler climate and fresh mountain air of San Cristobal de las Casas provides some respite from the city heat. Chilling out in this relaxed and visually stunning area is a magical Mexican moment.
5. Bus buddies
Catching a local bus in Mexico is a never-ending source of amusement. Overcome the language barrier and make friends with local commuters to pass the time.
6. Tequila!
No visit to Mexico is complete without downing a little bit of the national drink. While you may not remember every detail the morning after, good times and memorable holiday snapshots are guaranteed when tequila is involved.
7. Volcanic splendor
Mexico’s volcanic landscapes are photo-worthy and awe-inspiring. Hiking past rocky escarpments and surreal scenery is a rewarding travel experience to remember.
8. Village people
Sharing smiles and laughs with locals while strolling through the rural villages of Mexico is a simple, yet memorable way to see the real heart of Mexico - its people.
9. Mariachi melodies
Sway to the unique sounds of Mexico’s mariachi music in the streets and cafes of Mexico. The rhythms and beats will live in your heart for years to come.
10. To market, to market
Witness Latin America’s time-honored commercial traditions unfold in Mexico’s well-patronized markets. Hear the banter of stallholders, smell the fragrant scent of sizzling meat and admire the colorful array of wares on offer.
Top places to visit in Mexico
This coastal town is well-known for its incredible cliff-top Mayan temple ruins with expansive ocean views. But outside of architectural wonders, Tulum also has quite a few natural wonders. Spend some time exploring Tulum's numerous cenotes and caves for unforgettable snorkeling and diving.
Explore Tulum on our 8 day Yucatan Peninsula Adventure or on our 8 day Premium Mexico Yucatan Highlights tour.
Numerous significant architectural sites, baroque churches and impressive cultural displays may have landed Oaxaca the badge of Unesco World Heritage Site, but in recent years, the city has gained notoriety as a culinary destination. Make sure to try regional specialties like tlayudas, mole and mezcal.
Get a taste of Oaxaca on our 9 day Mexico Real Food Adventure.
3. San Cristobal
Set in a valley surrounded by pine forests, San Cristóbal de las Casas has a bright yellow cathedral, pastel houses and buildings draped in deep pink bougainvillea, making it one of Mexico's most colorful cities. Stop by the local markets to browse locally-made handicrafts with colors that rival those of the city itself.
Explore this colorful city on our 15 day Best of Mexico tour.
Travelers will be delighted with the range of good quality shopping available in Mexico. As usual, the markets offer some of the most cost-effective and fun ways to shop, although Mexico’s cities also showcase some excellent boutiques and galleries for more costly purchases.
It's a good idea to check with your local customs officials to ensure that you are able to bring certain items back into your home country. The United States and Canada generally have strict customs laws.
Things to buy in Mexico
1. Tiles, ceramics and earthenware
Mexico has a longstanding tradition of creating good-quality pottery. Hit the artisan markets for colorful pots, vases and jugs. Don’t forget to pack carefully.
2. Bright textiles
Woven textiles can be found almost everywhere in Mexico. Hand-woven rugs, blankets, scarves, and ponchos are great reminders of your time in Mexico.
The silver in Mexico is among the world's best. Rings, necklaces and bracelets featuring bold Aztec designs are popular choices.
4. Lucha Libre masks
This Mexican wrestling phenomenon is growing in popularity worldwide, so grab a colorful wrestling mask - it’s a great souvenir for kids (and big kids) at home.
Festivals and events in Mexico
Mexico is the land of the fiesta and the locals will find any reason to party. Whether they're celebrating independence, the saints or the dead, you can expect vibrant colors, lively music and a whole lot of dancing. One to keep an eye out for is the Autumn Equinox, when crowds gather at Chichen Itza to witness the sunlight and shadows play tricks on this ancient relic. During the autumn (and spring) equinox, the sun moves across Chichen Itza, illuminating parts of the temple to reveal the moving body of a snake. Not seen on any other days, this natural spectacle draws thousands of pilgrims.
Read more about festivals in Mexico
Further reading
Mexico travel faqs, do i need a covid-19 vaccine to join an intrepid trip.
Trips from 1 January 2023 onwards
From 1 January 2023, Intrepid will no longer require travelers to provide proof of vaccination against COVID-19 (excluding all Polar trips and select adventure cruises).
However, we continue to strongly recommend that all Intrepid travelers and leaders get vaccinated to protect themselves and others.
Specific proof of testing or vaccination may still be required by your destination or airline. Please ensure you check travel and entry requirements carefully.
When is the best time to visit Mexico?
Mexico is a country of varied landscapes and altitudes and the best time to visit depends on a variety of factors, the first of which is where you actually want to go.
Is it safe to visit Mexico?
Mexico has long been a popular tourist destination and most travelers do not run into any trouble. There are, however, areas that experience high levels of violent crime as a result of lawlessness and drug trafficking. That said, you can rest assured that Intrepid would not take you anywhere unless we were convinced it was safe.
Do I need a visa to travel to Mexico?
All tourists traveling to Mexico need a tourist permit, but not all need a visa. Citizens of the US, EU, Canada, the UK, Australia and New Zealand are among those who do not need a visa and can obtain a tourist permit on arrival.
Is tipping customary in Mexico?
Tipping is expected in most parts of Mexico. The service workers typically earn a low wage and rely on tips to earn a decent living. We recommend leaving 10–15 percent at restaurants (if the service charge is not already included), 5–10 percent of your room cost for housekeepers, and a few dollars for porters, bartenders and guides.
What is the internet access like in Mexico?
Internet access is good in Mexico with wi-fi available in most accommodations, bigger restaurants, airports and in some public spaces. It’s also easy and affordable to buy a local SIM card for the duration of your Mexico tour.
Can I use my cell phone in Mexico?
If you wish to use your cell phone while in Mexico be sure to activate global roaming before leaving your home country. You should also check with your provider regarding any charges you may incur when overseas.
If you wish to purchase a local SIM card in Mexico, your phone must first be unlocked. For more information on local SIM cards, please read about internet access in Mexico .
What are the toilets like in Mexico?
It's likely that you will encounter different types of toilets while traveling in Mexico. Western-style flushable toilets are commonly found in high-end resorts, hotels and restaurants, while squat toilets are common in rural areas and homes. Be prepared by carrying your own supply of toilet paper and soap, as these aren't always provided.
What will it cost for a...?
Mexico’s unit of currency is the peso:
- Cheap local meal = MXN 150.00
- Domestic beer at a restaurant = MXN 50
- One-way metro ticket in Mexico City = MXN 6.00
- Mid-range meal = MXN 400.00
Can I drink the water in Mexico?
We do not recommend drinking the water in Mexico.
For environmental reasons, try to avoid buying bottled water and fill a reusable water bottle or canteen with filtered water instead. Ask your leader where filtered water can be found; some hotels we stay in may have drinking water available, often boiled to use for tea or coffee.
It’s also advisable to avoid ice in drinks and to peel fruit and vegetables before eating.
Are credit cards widely accepted in Mexico?
Credit cards are generally accepted in Mexico at large stores and most mid- high-range hotels. Some cafes, bars and restaurants may accept card too, but the places with real character – and the best local food – tend to be cash only.
What is ATM access like in Mexico?
ATMs are available across towns and cities in Mexico. Travelers should not encounter trouble finding an ATM but be wary of international transaction fees. For your own safety, try to use ATMs in daylight hours.
What is the weather like in Mexico?
Mexico is renowned for its sunshine and sandy beaches, but the weather can vary depending on the region you’re traveling to and the time of year.
What public holidays are celebrated in Mexico?
- 1 Jan: New Year’s Day
- 5 Feb: Constitution Day
- 21 Mar: Day off for Benito Juarez’s Birthday Memorial (variable)
- April: Maundy Thursday/Good Friday (variable)
- 1 May: Labor Day
- 16 Sep: Independence Day
- Nov: Revolution Day Memorial (held 3rd Monday of the month)
- 12 Dec: Day of the Virgin of Guadalupe
- 25 Dec: Christmas Day
Please note: Mexico public holidays may vary.
Is Mexico safe for LGBTQIA+ travellers?
Mexico is becoming increasingly more accepting of same-sex relationships and has laws in place to protect those that identify differently, but it remains a country of strong Catholicism that has historically been hostile towards the local LGBTQIA+ community.
For more detailed and up-to-date advice, we recommend visiting Equaldex or ILGA before you travel.
If you are travelling solo on an Intrepid group tour, you will share accommodation with a passenger of the same gender as per your passport information. If you don’t identify with the gender assigned on your passport, please let us know at time of booking and we’ll arrange the rooming configuration accordingly. A single supplement is available on some tours for travellers who do not wish to share a room.
Is Mexico accessible for travelers with disabilities?
Intrepid is committed to making travel widely accessible, regardless of ability or disability. That’s why we do our best to help as many people see the world as possible, regardless of any physical or mental limitations they might have. We’re always happy to talk to travelers with disabilities and see if we can help guide them towards the most suitable itinerary for their needs and, where possible, make reasonable adjustments to our itineraries.
Tourist destinations in Mexico including Mexico City and the resort areas on the Yucatan Peninsula are seeing an increasing number of hotels, restaurants and tourist sights fitted out to accommodate travelers with limitations. That said, it can still be difficult for those with mobility issues and visual and hearing issues, particularly on public transport. We recommend using taxis to move around locally and flying between cities if possible unless, of course, you are on an Intrepid Mexico tour.
If you do live with a visual, hearing or other impairment, let your booking agent or group leader know early on so they’re aware and suitable arrangements can be made. As a general rule, knowing some common words in the local language, carrying a written itinerary with you and taking to the streets in a group, rather than solo, can help make your travel experience the best it can be.
What should I wear in Mexico?
What you pack for your Mexico tour will depend on where you are traveling to. Mexico City, for example, will be much cooler than the coastal areas of Playa del Carmen or Tulum, thanks to its high altitude. In the winter, it can drop down towards freezing at night while reaching 73°F during the day, so it’s important to be prepared for both ends of the spectrum.
What's the accommodation like in Mexico?
Traveling with Intrepid is a little bit different. We endeavor to provide travelers with an authentic experience to remember, so we try to keep accommodation as unique and traditional as possible.
When traveling with us in Mexico you may find yourself staying in a basic hotel.
Intrepid prefers smaller character-filled hotels and guesthouses than hotel chains. When on vacation in Mexico, enjoy staying in small hotels owned and run by friendly locals.
Does my trip to Mexico support The Intrepid Foundation?
Yes, all Intrepid trips support the Intrepid Foundation. In fact, we make a donation on behalf of every traveler. Trips to Mexico directly support our foundation partner, Gastromotiva Mexico.
Gastromotiva Mexico
Gastromotiva Mexico is tackling food scarcity and homelessness while promoting a sustainable food movement. Donations help them provide nutritious, balanced meals to community shelters for vulnerable people such as women affected by domestic violence and refugees.
Intrepid will double the impact by dollar-matching all post-trip donations made to The Intrepid Foundation.
How do I stay safe and healthy while traveling?
From Australia?
Go to: Smart Traveller
From Canada?
Go to: Canada Travel Information
From the UK?
Go to: UK Foreign Travel Advice
From New Zealand?
Go to: Safe Travel
From the US?
Go to: US Department of State
The World Health Organisation also provides useful health information.
Do I need to purchase travel insurance before traveling?
Absolutely. All passengers traveling with Intrepid are required to purchase travel insurance before the start of their trip. Your travel insurance details will be recorded by your leader on the first day of the trip. Due to the varying nature, availability and cost of health care around the world, travel insurance is very much an essential and necessary part of every journey.
For more information on insurance, please go to: Travel Insurance
What is it like traveling on a small group tour?
Whether you’re a seasoned traveler or you’re about to embark on your first trip, traveling can be as intimidating as it is exciting. That's the beauty of a small group tour. From handling the logistics and organizing amazing cultural activities to local leaders who know each destination like the back of their hand (like which street has the best markets and where to get the most authentic food), traveling on a small group tour with Intrepid will give you unforgettable travel experiences without the hassle that comes with exploring a new place. Plus, you'll have ready-made friends to share the journey with. All you have to do is turn up with a healthy sense of adventure and we’ll take care of the rest.
Deals of the Week Mad for the Med Up to 50% OFF
Fully Guided Tours & Trips in Mexico
Find the right fully guided tour for you in Mexico. There are 168 trips to choose from, that range from one day in length, up to 22 days. The month with the most departures is October, making it the most popular time to visit Mexico.
168 Fully Guided tour packages in Mexico with 779 reviews
Mexico Yucatán Experience
Extremely well organised and planned tour, we packed so much in to the 10 days and had the best time. The value you get for your money is brilliant, with a lot of activities included in the up front price and options to do extra when you are there. Lau the tour guide was amazing, extremely knowledgeable about the area and give great tips on sight seeing, bars, restaurants etc at every stop on the tour. Also as a girl travelling, I have never felt safer as part of her tour group. Great trip if you want to immerse yourself in the culture while also having time to relax on the beach, highly recommend. Only downside was not all the accommodation had AC and it was extremely hot, especially in Bacalar. Other than that amazing!
- In-depth Cultural
- Christmas & New Year
Classic Mexico Adventure
Our Classic Mexico tour with G-Adventures was an entirely pleasant and enjoyable experience, owed in large part to our extremely friendly, efficient and knowledgeable tour guide Salvador, himself a native of the Maya region of Yucatan. We enjoyed the opportunities to have meals with local hosts within a family environment that Salvador had arranged for us. While there were minor draw-backs with one or two of the hotels they were always in conveniently central locations, allowing exploration of those lively town centers on foot. Transportation of our group of 14 always ran like clockwork, including travel by air from Oaxaca via Mexico City to Villahermosa. We are very glad to have chosen this trip and will not easily forget the manifold impressions of the rich history, culture and friendly people of southern Mexico.
Yucatan Adventure: Merida, Tulum & Jungle Swims
Mexico is an amazing place and having the opportunity to live it with a local guide and an amazing group is even better!
Premium Mexico Yucatan Highlights
Great. Exceeded our expectations Selected experiences were all highlights. Hotels fine - some minor niggles but no worries. Big rave for Alejandro - our guide. Just made the trip so alive and interesting.
- Food & Culinary
Mexico Real Food Adventure
Great intro into Mexico with what underpins all cultures. Food!
- Coach / Bus
- Sightseeing
Mayan Adventure
i am amazed at the care shown about where we were and how we were doing. I wish we could have had more time to wander around the ruins especially at chichen itza. If iIhad to do it again I would have skipped Cancun completely and spent two days at the ruins. Miguel was just awesome and he is so smart he needs to learn more about the ruins and the history like the guide we had at chichen itza. HOWEVER, his knowledge about the Mayan people was incredible. I had recent surgery on my foOt and wore a brace,Miguel was so kind and helpful I got to see everything , even climbed the stairs at Pelenque. WOULD RECOMMEND THE TOUR HIGHLY.
Colonial Mexico ( 9 days )
Capitals of Mexico ( 7 days )
Mexico Unplugged
Colonial Treasures of Mexico
My wife and I along with three friends signed up the tour to Mexico from Indus Travel. The total 12-day Maya Culture trip really gave us opportunities to learn Mexico indigenous cultures thoroughly. We have seen a lot of ruins and pyramids, each of them has different representations and can tell the history of what was happening atthat time. We also had chances to visit the indigenous families toexperence the real Mexican people's life inthe rural area. The views of volcanoes, villages and canyons are also unforgettable. This is a small group with total 7 tourists, our driver/tour guide is a very experienced guide, Jose explained the history in sequence of events in and out. Most of all with 2500km driving he made us fell safe with his skills. All in all, this trip worths a 5+ star. I was so surprised that Indus Travel assigned a tour coordinator dedicated to our group, Kathlene helped a lot to make the arrangements for the whole trip, her prompt responses made us worry free.
Viva Mexico
I would give this tour six stars if I could. Ethan and the gang really bring Mexico to life. Would recommend this tour to anyone!
8 Days Tailor-Made Best Mexico Tour, Daily Start
Our guide Enrique and driver Riccardo we’re both very accomodating and provided great support making our trip stress free. At every stop Enrique checked accomodation, explained breakfast, meals and checked the room. His knowledge of each site and the historical context of significant events was exceptional. We would highly recommend this trip with this guide and driver
- Book With Flexibility This operator allows you to rebook your dates or tours with them for free, waiving change fees.
Mayan Route
- 10% deposit on some dates Some departure dates offer you the chance to book this tour with a lower deposit.
Premium Mexico in Depth
Yucatan Highlights (6 Days)
Contiki went above and beyond - my whole trip was jam packed full of amazing "cultural experiences"! I'd definitely go Contiki again!!
- €100 deposit on some dates Some departure dates offer you the chance to book this tour with a lower deposit.
What people love about Fully Guided Tours in Mexico
Exploring Mexico with Trutravels was incredible! Despite the cost, every moment was priceless. Our guide, Evelyn, with her 12 years of experience, made the trip exceptional ❤️?? The highlights were truly unforgettable: - Witnessing the awe-inspiring Chichen Itza, a true marvel. - Taking the plunge into the refreshing cenotes, each one a hidden gem. - The breathtaking 7 colors Lagoon of Bacalar left us speechless. - And let's not forget the delicious daily delights of tacos, enchiladas, and guacamole! ? ? Can't wait for the next organized adventure! ✈️
Excellent guides. Should prepare travellers that the local tours accept only cash payments, I almost didn't have enough because I had thought they could be paid by card.
Der Guide, die Gruppe, alles einfach top! Würde ich jederzeit wieder buchen und kann die Tour nur weiterempfehlen.
Regions in Mexico
- Central Mexico (34)
- Pacific Coast Mexico (23)
- Yucatan (8)
- Chichen Itza (8)
- Western Caribbean (7)
- Chiapas (6)
- Copper Canyon (5)
Travel Styles
- Fully Guided
- Mexico Travel Guide | All You Need to Know
- 10 Best Mexico Vacation Packages 2024/2025 (with Reviews)
International Versions
- Deutsch: Geführte Rundreisen in Mexiko
- Français: Mexique : Circuits entièrement guidés 2024/2025
- Español: Totalmente guidado Circuitos en México
- Nederlands: Volledig begeleid Rondreizen in Mexico
Search Flights X
- Mexico Tour Packages
Accommodation
Packages available from
Rs. 93,140 - Rs. 1,67,739
Per Person on Twin Sharing
An OTP (valid for next 15 mins.) has been sent to you on your Mobile number
By clicking Submit, I agree to yatra.com Terms of use and Privacy Policy
A marketplace of suppliers
Real time, end to end customization
Stay in touch with our expert on live chat
Get the Best Holiday Planned by Experts!
- Enter Your Mobile Number
By submitting this form, you authorize Yatra.com and its partners to contact you for this enquiry.
- Get Free Quotes
Message Sent!
Thank you for submitting your holiday request. A Yatra representative will call you within the next 2 hours from 9990614615.
- By submitting this form I confirm that I am either over 18 years of age or possess legal authority to consent on behalf of the individual whose information has been provided above. I am willing to be contacted by Yatra and its third-party service providers for sale and promotion of travel related products and services. I allow Yatra to share my personal information like my name, email, phone number, destination city and date of travel with the third-party service providers. I understand that once my personal information is shared with the third-party service providers, Yatra would have no control over the same and these third parties may use my personal information for any subsequent marketing and sales communications for travel related products and services. Additionally, they may further share my information with their third parties.
- International Tour Packages
About Mexico Tour Packages
- All Packages (4)
- Customizable (4)
Mystical Mexico
- Seller : Yatra
Per Person on twin sharing
Mystical Mexico ( Deluxe)
Best Of Mexico
Best Of Mexico ( Deluxe)
Popular mexico tour packages, popular world tour packages.
- Places to visit
- Best time to visit
- How to reach
- Thing to do
- Sri Lanka Family Packages
- Europe Family Packages
- Switzerland Family Packages
- Mauritius Family Packages
- Dubai Family Packages
- Bali Family Packages
- Maldives Family Packages
- Singapore Family Packages
- Malaysia Family Packages
- Australia Family Packages
- Turkey Family Packages
- Greece Family Packages
- Spain Family Packages
- Vietnam Family Packages
- France Family Packages
- UK Family Packages
- Canada Family Packages
- Mexico Family Packages
- Florida Family Packages
- New Zealand Family Packages
- Places to vist in Bali
- Places to vist in Mauritius
- Places to vist in London
- Places to vist in Paris
- Places to vist in Dubai
- Places to vist in Maldives
- Places to vist in Bangkok
- Places to vist in Hong Kong
- Places to vist in Venice
- Places to vist in Sydney
- Places to vist in Cape Town
- Places to vist in Amsterdam
- Places to vist in Melbourne
- Places to vist in Colombo
- Places to vist in Mansarovar
- Places to vist in Kathmandu
- Best time to visit Maldives
- Best time to visit Singapore
- Best time to visit Bali
- Best time to visit Dubai
- Best time to visit Bangkok
- Best time to visit Kathmandu
- Best time to visit London
- Best time to visit Mexico
- Best time to visit Paris
- Best time to visit Mansarovar
- Best time to visit Toronto
- Best time to visit Hong Kong
- How to reach Maldives
- How to reach Dubai
- How to reach Bali
- How to reach Paris
- How to reach Kathmandu
- How to reach Mansarovar
- How to reach New York
- How to reach Colombo
- How to reach London
- How to reach Mexico
- How to reach Toronto
- How to reach Hong Kong
- Things to do in Bali
- Things to do in Maldives
- Things to do in Dubai
- Things to do in Mauritius
- Things to do in London
- Things to do in Paris
- Things to do in Kathmandu
- Things to do in Mansarovar
- Things to do in Venice
- Things to do in Sydney
- Things to do in Bangkok
- Things to do in Hong Kong
- Things to do in Cape Town
- Things to do in Amsterdam
- Things to do in Melbourne
- Things to do in Colombo
- Family Holidays
- Honeymoon Holidays
- Winter Holidays
- Summer Holidays
- Beach Holidays
- Hill Station Holidays
- Exotic Holidays
- Adventure Holidays
- Wildlife Holidays
- Affordable Holidays
- Luxury Holidays
- Cruise Holidays
Top International Flight Routes
- Delhi to Dubai Flights
- Mumbai to Dubai Flights
- Delhi to Toronto Flights
- Delhi to Singapore Flights
- Ahmedabad to Dubai Flights
- Delhi to Kathmandu Flights
- Bengaluru to Dubai Flights
- Mumbai to Bangkok Flights
- Mumbai to Toronto Flights
- Chennai to Colombo Flights
Looking for a Holiday Package?
Our Company
- More About Us
- Leadership Team
Our Products
- Customer Testimonials
- Press Releases
- Support & FAQs
- Terms & Conditions
- Privacy Policy
- User Agreement
- Retails Stores
- Visa Information
Top Travel Destinations
- Switzerland Tourism
- Bali Tourism
- Dubai Tourism
- Maldives Tourism
- Bhutan Tourism
- Vietnam Tourism
- Srilanka Tourism
- Thailand Tourism
- Singapore Tourism
- Malaysia Tourism
- Andaman Tourism
- Lakshadweep Tourism
- Goa Tourism
- Kerala Tourism
- Himachal Tourism
- Kashmir Tourism
- Gujarat Tourism
- Uttarakhand Tourism
- Meghalaya Tourism
- Leh Ladakh Tourism
Popular Honeymoon Packages
- Maldives Honeymoon Packages
- Bali Honeymoon Packages
- Singapore Honeymoon Packages
- Europe Honeymoon Packages
- Dubai Honeymoon Packages
- Malaysia Honeymoon Packages
- Thailand Honeymoon Packages
- Mauritius Honeymoon Packages
- Indonesia Honeymoon Packages
- Manali Honeymoon Packages
- Goa Honeymoon Packages
- Andaman Honeymoon Packages
- Ooty Honeymoon Packages
- Darjeeling Honeymoon Packages
- Kerala Honeymoon Packages
- Ladakh Honeymoon Packages
- Shimla Honeymoon Packages
- Munnar Honeymoon Packages
- Himachal Honeymoon Packages
- Kashmir Honeymoon Packages
- India Tour Packages
- Goa Tour Packages
- Manali Tour Packages
- Andaman Packages
- Ladakh Tour Packages
- Kerala Tour Packages
- Kashmir Tour Packages
- Rajasthan Tour Packages
- Ooty Tour Packages
- Uttarakhand Tour Packages
- Himachal Tour Packages
- Darjeeling Tour Packages
- Sikkim Tour Packages
- Jaipur Tour Packages
- Srinagar Tour Packages
- Munnar Tour Packages
- South India Tour Packages
- North India Tour Packages
- Kedarnath Tour Packages
- Lakshadweep Tour Packages
- Shimla Tour Packages
- Goa Packages from Delhi
- Goa Packages from Bangalore
- Gangtok Packages from Delhi
- Gangtok Packages from Kolkata
- Kalimpong Packages from Kolkata
- Maldives Tour Packages
- Bali Tour Packages
- Singapore Tour Packages
- Europe Tour Packages
- Greece Tour Packages
- Switzerland Tour Packages
- Dubai Tour Packages
- Malaysia Tour Packages
- Thailand Tour Packages
- Mauritius Tour Packages
- Bangkok Tour Packages
- Bhutan Tour Packages
- Nepal Tour Packages
- New Zealand Tour Packages
- Russia Tour Packages
- Turkey Tour Packages
- Egypt Tour Packages
- Canada Tour Packages
- Saudi Arabia Tour Packages
- Bahrain Tour Packages
Important Links
- World Tour Packages
- Honeymoon Packages
- International Honeymoon Packages
- Weekend Getaways
- Chardham Yatra
- Pilgrimage Packages
- Cordelia Cruise Packages
- India Tourism
- International Tourism
- Holiday Offers
- Port Blair Packages
- Chardham Packages
- Chardham Yatra by Helicopter
- Dalhousie Packages
- Dharamshala Packages
- Havelock Packages
- Gangtok Packages
- Kalimpong Packages
- North East Tour Packages
- International Flights
- Domestic Flights
- Domestic Airlines
- Cheap Flights
- Flight Schedule
- Flight Status
- Web Check In
- Hotels in India
- Hotels Near Me
- Bus Booking
- Cab Booking
- Outstation Cabs
- Indian Railways
- Distance Between
- Train Running Status
- Train PNR Status
- IRCTC Forgot Password
- Domestic Tour Packages
- State Wise Travel Guidelines
- Monuments of India
- Charter Flights
- Qutub Minar
- Visa at Your Doorstep
- Uk Visa At Your Doorstep
- Armed Forces Flight Booking
- Senior Citizen Flight Booking
- Student Quota Flight Booking
- No Cost EMI on Flight Tickets
- 1800-123-5555
- Travel Agent? Join Us
Get Travel Triangle in your pocket.
Get your app via sms
- Honeymoon Packages
- Family Packages
- Holiday Packages
- Holiday Deals
- Luxury Holidays
- Destination Guides
- Holiday Themes
- Plan My Holiday
Indian Destinations
- Uttarakhand
International Destinations
- Switzerland
- Sikkim - Gangtok - Darjeeling
- South Africa
Seasonal Packages
Water Activities
Mexico Tour Packages
- Tour Packages
- International
Mexico Holiday Packages : rated 3.5 /5 (based on 10 reviews)
Mexico Holiday Packages
What makes Mexico a special travel destination is the experiences that it has to offer. The friendly people and the quirky colonial town sights that one gets to enjoy, in a great affordable price range makes the vacation even more mesmerizing with our Mexico trip packages .
Places To Visit
1. mexico city.
Steeped with history and culture, Mexico is the most populous city in Mexico. This city is the home to the ancient Azrec sites, world class hotels and a lot of cultural attractions.
Trips to Mexico would be incomplete without exploring Cancun. The sand beaches, great nightlife, all-inclusive high-end resorts makes it a easy-to-go beach gateway for vacations.
This island in Mexico is the best known place for its coral reefs and cruise ships.This place is one stop destination for blue water, laid back beaches and offers water sports like kayaking, snorkelling, paddleboards etc.
Tulum is an excellent destination to add in Mexico packages for history buffs and water lovers. This place is home to the world’s only waterfront Mayan ruins.
This is colonial city which is known for its rich Mexican culture. You can explore the vibrant markets here and taste relishing Mexican cuisine. The must visits are Templo de Santo Domingo church and the preserved ruins of Monte Alban.
Best Time To Visit
As Mexico is a huge country with a micro-climate divisions, one can visit Mexico any time depending on the place of visit.Mexico experiences two main seasons throughout the year - the dry season and the rainy season.
Dry season in Mexico
Book Mexico vacation in the dry season between the months of December to April for an awesome climate. In the winter season between December to February, the weather is cool making it the best time to explore all the cities, coasts and all the places.
Rainy season in Mexico
One should must avoid the Hurricane season in Mexico as this time encounters hurricane in this season which lasts between the months from June to November. The rainfall is heavy and quite sudden.
How To Reach
Due to geographical location of Mexico, the most obvious and convenient way to travel to Mexico is by air but there are also alternative ways by sea and rail.
Mexico is home to many efficient airports, among them Benito Juarez International Airport is the busiest and nearest to Mexico city.The metro cities of India is well connected with Mexico but there is no direct flights from India. From Delhi to Mexico, by the fastest way, the flight duration is around 23 hours. Mexico vacation packages are available with the option of with or without air tickets, so the travelers have the choice to make at their discretion.
There are glorious cruises from India to various destinations in the world but Mexico isn’t one of them. But if you really want to travel by a cruise to Mexico, then there are also some options for you.One can fly to U.S and then take a cruise to Mexico.
It would be geographically impossible to travel to Mexico from India by road or by train.So, there is no direct train to Mexico.One can take a flight to US and reach Mexico by road.Mexico is connected to the US cities in New Orleans, Houston, Tucson and LA.
Shortlisted Packages
- No packages to compare. Please add using ‘Add to compare’ button.
- Select at least two packages
Duration ( in Days )
Budget Per Person ( in Rs. )
Hotel Star Rating
Your Requirements are unique!
Our experts would love to create a package just for you.
FAQs for Mexico
How far in advance should i book a flight to mexico.
For a trip to Mexico, one should must book flight before 3 months but for peak seasons in summer months one should must book flight before 4 months.
What is the cheapest time to fly to Mexico?
You can fly to Mexico in the month of October for cheap flight tickets.
How much should I take to Mexico for a week?
On an average you can set a budget on $70 per day, that makes around $500 or more for a week.
Is it dangerous to travel to Mexico city?
Mexico City is not a really dangerous city, but you should avoid some places especially if you don’t speak Spanish.
Where should I avoid in Mexico City?
You should must avoid places like Tepito, La Merced Market, Colonia Del Valle, Iztapalapa neighborhoods.
Whats food to try in Mexico?
One should must try the traditional breakfast Chilaquiles, along with other famous dishes such as Pozole, Tacos al Pastor, Enchiladas, Mole etc.
What to buys from Mexico?
One can buy Taxco silver, Chocolate, Hot Sauce, Fals blanket, wooden baskets etc.
Why Book With Our Agents?
Only The Best Agents
Travelers deal with only the top 10% reviewed agents who are selected after a 23 step rigorous assessment procedure by TravelTriangle.
Ensuring Quality
TravelTriangle ensures quality service via verified partners by releasing the payment only after the booking vouchers/receipts are received by the traveler.
24*7 On-trip assistance by Local Travel Agents
Things To Do
1. art tour at mexico city.
Mexico City is the cultural heart of Mexico and home to numerous art galleries and museums.
2. Enjoy the day of the Dead at Oaxaca
On November 2nd, the Day of the Dead is celebrated with great pomp and show. In this day numerous vigils and rituals are performed with addition night parties and carnival through streets by locals dressing into traditional dress.
3. See marine fauna at ‘World’s Aquarium’
At the northwest coast of Mexico in Baja California, known as ‘World’s Aquarium’, take a boat ride and you may see blue whales, fin whales, sperm whales dolphins and etc.
4. Taste the Tequila
The tequila here is made of 100% agave has a savouring flavour which is better to taste.Don’t miss to get drunk by this fiery shots at Amatitan on your Mexico vacation .
5. Go for a road trip
Explore the hidden corners by taking a road trip around the country.Start with a road trip in Yucatan then head to Chichen Itza, then to the ‘yellow city’ of Izamal.
- Do learn some Spanish words, use in your sentence to communicate with local.
- Do not book your flight with VivaAerobus.
- Get a health insurance before travelling to Mexico as many fears about the crime at this place.
- From immigration office with your stamped passport, you will get a piece of paper stick to it. Do not lose it.
To get the best of the deals on the Mexico Tour Package , log onto our website. Enjoy an exotic holiday at this biodiverse location.
- We are hiring!
- Testimonial
- Travelogues
- Terms and Conditions
- Privacy Policy
Corporate Office:
Holiday Triangle Travel Private Limited
Address: Plot No - 52 , 3rd Floor,
Batra House , Sector 32,
Gurugram - 122001 ,Haryana
Landline: 1800 123 5555
Connect with us on :
All rights reserved © 2024
You are using an outdated browser. Please upgrade your browser to improve your experience.
We use cookies to improve your website experience and provide more personalized services to you, both on this website and through other media. By continuing to use this website, you agree to our use of cookies as explained in our Cookie Policy . Please read our Cookie Policy for more information on how we use cookies and how you can disable them.
New User? Register
- Manage bookings
- Cancellation
- On Behalf Booking
We're unable to sign you in because the password entered incorrect.
Your request for OTP will be sent to registered email id and mobile number, if not registered please do the same.
You exceed the OTP limit. Please try again after some time
Don't have an account?
- Contains between 8-12 alphanumeric characters.
- Can add special character but not mandatory(Only !, @, #,$,%,^,&,* to be used).
- Does not contain White spaces
I would like to be kept informed of special Promotions and offers. I hereby accept the Privacy Policy and authorize Thomascook to contact me.
Already have an account?
- Your existing Google or Facebook Id will be a Thomascook ID
- No need to remember different Ids & Passwords
- One Click login
Fill in the email Address that you used to register or book with Thomascook.
We will reset and send your new password.
Please enter the valid email address
Thomascook Staff / Preferred Agents / corporate's, please enter your Login-id only. E.g. Tcil_aalok / Jaft_prakash / Rc_mumbai
Your request for new password has been accepted.
The new password would be emailed to the registered email address, if not registered please do the same
The page you searched is temporarily unavailable
Kindly use the links below..
- international tour packages
- mexico tour packages
Oops! We could not find any result for the given search.
Sorry, the fields marked in red need your attention, please fix them to continue.
Mexico Tour Packages
Holiday tour packages (trending).
International Tour Packages
India & Around Tour Packages
I accept Privacy Policy and I authorise Thomas Cook Group Companies to contact me.
International Tour Packages (Trending Destinations)
Europe Tour Packages
Stroll through the beaches and explore the wild in the cultural island with your better half. Maldives is an all-in-one experience.
USA Tour Packages
Visit USA - the third largest continent in the world. Packed to the brim with personality, charm, diversity and great natural beauty.
Australia Tour Packages
A trip to Australia is a must if you crave for a blend of adventure, scuba diving, colorful mountains, rich wild life and much more.
New Zealand Tour Packages
Unending vistas of breath-taking landscapes await you at New Zealand – Fall in love with huge mountains, clear waters, adventure, wildlife & more.
Asia Tour Packages
The land of hidden gems, unexplored grasslands, temple towns, bustling streets and golden beaches; this is Asia for you.
Mauritius Tour Packages
They say that Mauritius was fashioned out of the handbook of the Gods. For the most part, it’s true.
Singapore Tour Packages
Bling and sparkles everywhere with tall buildings, scrumptious food, and lightning speed transport - Singapore deserves a spot on your ultimate holiday bucket list.
India Tour Packages & Around
Andaman Tour Packages
The Andamans - A wonderland of teal and turquoise. Where the seafood is more flavourful, and the fruits are juicier.
Kerala Tour Packages
Welcome to God's own country. Kerala is where tranquil backwaters, manicured tea estates, enchanting forests, beguiling mountains await you.
Himachal Tour Packages
The land of Gods awaits your visit. Choose to relax & enjoy its stunning beauty with the love of your life or wish to heed your spiritual call & discover yourself.
Rajasthan Tour Packages
Rajasthan synonym Royal, Regal, Revered. A magical universe of colour coded kingdoms. A place where little red turbans and green saris dance to classical music.
Kashmir Tour Packages
Experience Heaven on Earth. Beautiful verdant mountains and valleys, religious shrines, temples, wildlife, art and culture, festivals and much more.
Sri Lanka Tour Packages
A teardrop, found sliding along the Indian Ocean, is the magical land of Sri Lanka. It's is a magical, beautiful and diverse nation.
Bhutan Tour Packages
Bhutan is a jumble of impressions. A melange of sight, sound and taste. And its a one of a kind place where happiness is measured.
Mexico is a beautiful country in the southern portion of North America, bordered by the United States on the north and Guatemala and Belize on the southeast. It is a vast country filled with tons of cultural, historical and geographical diversity that one can witness during their stay. From dense green forests and rugged desert terrain to ruins of ancient civilisations and traces of modern history, there is a plethora of renowned Mexico tourist attractions for you to witness and explore.
Hence, if you are interested in gaining more in-depth knowledge about foreign culture and history, Mexico can be an ideal option. Whether it's a short adventure trip with friends or a long vacation with family, you can find the right Mexico tourism packages that fit your travel needs on our website. Thomas Cook offers multiple Mexico tour packages within most budget ranges to assist tourists in getting the best travel experience. From an 8 Nights/ 9 Days trip to all the way up to a 19 Nights/ 20 Days trip, these professionally organised Mexico tour packages offer the best value for your buck. In addition, these Mexico tour packages take care of most of the crucial aspects of setting up a foreign vacation, such as Mexico sightseeing, hotels, meals, etc., so you don’t have to deal with them yourself. As of now, the lowest available Mexico tour package price from India is INR 2,47,000.
Table of Contents
- Popular Mexico Tour Packages
- About Mexico Holidays
- Best time to visit Mexico
How to reach Mexico
- Best Places to Visit in Mexico
- Best Hill Stations/Beaches in Mexico
- Best honeymoon destinations in Mexico
Things to do in Mexico
- What to Eat in Mexico
- What to Shop in Mexico
- Interesting Facts about Mexico
- Mexico Culture
- Mexico Visa for Indians
- Foreign currency for Mexico
Most Popular Mexico Tour Packages 2023
About mexico holiday.
While looking for Mexico package holidays, research and learn about the destination first. Mexico, officially called the United Mexican States, is a country in North America covering a total area of 1,972,550 square kilometres. This page aims to offer interested travellers key details about the destination so they can choose from the most suitable Mexico tourism packages from India. For instance, there are tons of places to visit in Mexico for history buffs, such as the jaw-dropping ruins of the ancient civilisation of the Aztecs and Maya. Its vibrant and diverse culture also plays a massive role in promoting regional tourism, with things like Fiestas, Carnivals, Mariachi Bands, Jarabe Tapito, etc. The country is also a key adventure hub, offering opportunities for kayaking, ziplining, whitewater rafting, hiking, etc., which you may or may not find included in popular Mexico tourism packages. The actual Mexico trip cost, however, depends on a lot of factors, including trip duration, time of visit, total travellers, etc.
If you wish to experience all these in style, check out the Mexico tour packages available on our page. You can find Mexico package holidays from major Indian cities, including Delhi, Mumbai, Kolkata, Chennai, Hyderabad, Ahmedabad, Bangalore, etc.
Best time to visit Mexico
While you can find Mexico tour packages for every season, select a timeline that fits your trip expectations. These are the season-wise Mexico tour experiences;
Mexico in winter
The winter season in Mexico stretches from December to February. The weather condition stays quite pleasant with an average temperature of around 20°C. You can expect to witness snowfall in the highlands of northern Mexico. Due to all these, winter is considered the best time to visit Mexico. The best month to visit Mexico to witness snow in some northern regions is December. You will have no problem finding Mexico package holidays for the winter season.
Mexico in spring
Spring in Mexico starts around March and extends till May. The average temperature range stays around the mid-20s and only slightly increases towards May. You can expect rainfall from April, which highlights the region’s natural beauty. Spring is actually one of the shoulder seasons for Mexico tour but you can still find Mexico package holidays for this season. Besides winter, it is the best season to visit Mexico for holidays.
Mexico in summer
Summer is the off-season for tourism in Mexico. It stretches from June to August and features extreme temperatures around 30°C to 40°C. It is also known as the hurricane season, which is why tourists generally avoid making Mexico travel plans around these months. You can easily find Mexico tour packages for summer on our page. Summer is generally termed as the best season for Mexico tourism on a budget.
Mexico in autumn
Autumn, from September to November, is the other shoulder season for the Mexico tour. The temperature hovers around the 30°C mark in the southern parts and the 20°C mark around the northern regions. You can find Mexico packages for the autumn season without much worry.
Indian travellers on their Mexico tour can use the following modes of transport to reach the country;
The easiest and most popular way to travel to Mexico from India is via flight. Mexico has multiple international airports that help it to stay connected to major parts of the world. While there are no direct flights operating from India to Mexico, individuals can easily find connecting flights from major Indian cities, including Delhi, Mumbai, Bangalore, etc. Some popular Mexico package holidays may include optional flights. As winter is the best time to go to Mexico, consider booking flights in advance to avoid unavailability.
By Road/Rail
There is no direct road or rail system that connects India to Mexico. One can alternatively travel to the USA from India and then continue their journey to Mexico by road. It is not recommended because it requires a lot of paperwork and time, so look for Mexico packages that include flights.
There are no direct cruise ships that sail from India to Mexico. However, tourists can first reach the USA and then board a cruise from one of its ports to reach Mexico . Some Mexico tour packages may or may not include transportation.
Places to visit in Mexico
Here are some of the best places to visit in Mexico:
Mexico City
Mexico City is the country’s capital and a standard inclusion in most Mexico tour packages. It is one of the best places in Mexico where you can experience and witness the authentic regional cuisine, culture and traditions alongside major historical sites and architectural masterpieces. Some of its highlights include the Historic Centre of Mexico City, Teotihuacan, Xochimilco, Coyacan, Chapultepec, etc., which are often included under sightseeing in most Mexico package holidays.
Copper Canyon
The Copper Canyon is among the top Mexico tourist attractions. Comprised of a series of six separate canyons, it is a site of immense natural beauty and historical importance. This UNESCO World Heritage Site is sometimes also called the “Grand Canyon of Mexico” and is seen in the majority of Mexico packages.
Chichen Itza
The archaeological site of Chichen Itza is one of the best places in Mexico for history buffs. This UNESCO World Heritage Site is one of the finest restored evidences of the Mayan Civilisation. Its main attractions include the giant El Castillo and the almost 1000-year-old Caracol. Make sure to add this site to your customisable Mexico package holidays.
Oaxaca is also among the most well-known tourist places to see in Mexico. Individuals interested in experiencing the real cultural side of the country will find this city interesting. Some of its main attractions are the Oaxaca Cathedral, Monte Alban, the Cultural Centre, etc. If you can’t find Oaxaca in Mexico packages, add it by contacting your trip operator.
Best hill stations/ best beaches in Mexico
Following are some renowned beaches and hillside destinations in Mexico that you can check out;
Hill stations
Ajusco is one of the best tourist places in Mexico for a hillside vacation. It is basically a 3,930-metre-high lava dome, making it the highest point in the city. Tourists love to have a short stay in this area and check out its surrounding beauty during their Mexico travel. It is often included in some Mexico tour packages.
This small mountain town, 177 km from Puebla, is one of the most beautiful places to visit in Mexico. The rustic town buildings surrounded by densely covered green hills offer some of the best picturesque views. Consider adding Cuetzalan to your Mexico package holidays.
Pico de Orizaba
Pico de Orizaba is among the most famous Mexico tourist places that you can check out. This 5636-metre-tall, inactive stratovolcano is the highest peak in the country. Found in major Mexico packages, tourists love to visit Pico de Orizaba for its breathtaking scenic beauty and hiking adventures.
Playa Cerritos
Playa Cerritos in Baja California Sur, Mexico, has been a major spot for surfing adventures. It is among the few Pacific beaches in Baja where you can swim safely. It is included in many Mexico package holidays and remains filled with tons of tourists around the year.
Playa Carrizalillo
The Playa Carrizalillo is a secluded beach in Mexico’s Puerto Escondido. One has to descend 160 steps to reach this beach, which is a small but beautiful sandy stretch surrounded by swaying palm trees on one side and clear blue seawater on the other. You can find this beach in most Mexico package holidays.
Playa del Amor
Playa del Amor, also known as the Lover’s Beach, is a very popular beach in Mexico. Located in Cabo San Lucas, the golden sand, turquoise sea water, and the backdrop of giant arid rock formations make it one of the most eye-catching tourist attractions in Mexico. You can find Playa del Amor in popular Mexico tour packages.
Best honeymoon destinations in Mexico
Check out the following places to find a romantic destination for your honeymoon in Mexico;
Playa del Carmen
This resort city in Quintana Roo is a renowned destination for a honeymoon in Mexico. Playa del Carmen is known for its major tourist attractions, including vibrant nature reserves and beautiful white-sand beaches. Also, the availability of luxury accommodations for married couples and an exuberant nightlife scene makes it a prominent choice for honeymooners. You won’t have a problem finding a Mexico honeymoon package that includes this location.
Besides being known for Mexico family tours, Cancun is a wildly popular honeymoon destination. This city is a complete vacation spot featuring all the honeymoon essentials, from luxury resorts and restaurants to beautiful beaches and vibrant nightlife. You can customise a Mexico honeymoon package that includes Cancun.
Newly married couples can easily add Puebla to their honeymoon Mexico travel plan. It is also one of the best Mexico places to visit to try out delicious regional dishes, especially desserts, during a Mexico trip.
If you are looking for some fun things to do during your Mexico trip, here are some options to consider;
Horseback ride to Chamula
During your Mexico tour, take a horseback ride to San Juan Chamula and enjoy the journey while soaking in the surrounding natural beauty and daily rural life in the region.
Ride a hot air balloon over the Ruins of Teotihuacan
Exploring the remarkable ancient ruins of Teotihuacan in Mexico on a hot air balloon is one of the best things to do in Mexico. Enjoy the breathtaking, top-view perspective of this archaeological site to spice up your Mexico tour experience.
Ride a train through Copper Canyon
Exploring the immense natural beauty of the renowned Copper Canyon by travelling on the El Chepe, otherwise called the Copper Canyon Train, is one of the best things to do in Mexico. Make sure to add it to your Mexico travel plan.
Learn surfing in Sayulita
If you keep an interest in surfing or learning the art of surfing, there’s no better place to try it than Sayulita Village during your Mexico tour. Note that you may or may not find surfing as a standard inclusion in most India to Mexico tour package options.
What to eat in Mexico
Alongside looking for Mexico tours all-inclusive plans, don’t forget to research the authentic regional dishes. Some well-known options are;
Menudo, also called Pancita, is a popular dish in Mexico. It is a seasoned soup prepared with ingredients like beef tripe and corn kernels over a chilli pepper base. Don’t forget to add this to your Mexico travel plan.
Quesadillas are either flour or corn tortillas that are folded in half and have a filling made of cheese and a few other ingredients. It is then grilled or deep-fried and consumed while hot. It is not usually included under meals in most Mexico packages tour plans.
Mexican Flan is a flavourful regional sweet dish you can try during your visit. It is a baked custard made with whole eggs and evaporated and condensed milk, finally topped with light sugar syrup.
Do not forget to try the authentic tacos during your Mexico trip. It is a folded tortilla with a filling in the middle made of offal, steak, chorizo, onions, etc. Mexico City is one of the best places to visit in Mexico for delicious Tacos.
Burritos are another signature Mexican food that you can find everywhere. It is a rolled flour-made tortilla with a stuffing made of meat, cheese, refried beans, chopped vegetables, etc.
What to shop in Mexico
Here are some things you should look for when shopping in Mexico;
Mayan Wooden Mask
These finely carved wooden masks depict various natural symbols, ancient deities and jungle animals tied closely to the Mayan culture. These beautiful art pieces are perfect home decor items that you buy in Mexico.
Where to buy: These masks are available all-around major cities included in Mexico trip packages, especially the open markets.
Lucha Libre Mask
If you are a wrestling fan, you will love the Lucha Libre Masks sold all around Mexico. These colourful masks help symbolise the native form of freestyle wrestling in Mexico and are very affordable.
Where to buy: The street market in San Miguel de Allende, Guanajuato, is a great place to buy Lucha libre masks. So, consider looking for Mexico tourist packages that include Guanajuato.
Mexican Chocolate
Authentic Mexican chocolate is a delicious and compact gift idea that you can consider. It is perfect for cooking and making hot chocolates and can also help satisfy your sweet tooth as a quick snack.
Where to buy: Some of the best places to buy Mexican chocolate are from the local shops in Oaxaca, Chiapas and Tabasco. It is best to go with Mexico tourist packages that include a short stay at these locations.
Mexican Coffee Beans
Mexican coffee beans are another affordable regional product you can buy as a gift or for self-consumption during your trip.
Where to buy: Consider buying Mexican coffee beans from the local markets in the country’s southern states, which you can find in some Mexico trip packages.
Interesting facts about Mexico
While searching for Mexico travel all-inclusive packages, check out some lesser-known facts about the country that every tourist should know about;
- Mexico has a total of 35 UNESCO World Heritage Sites within its territory, including the likes of Chichen Itza, Teotihuacan, Uxmal, Queretaro, Guanajuato, etc.
- The world’s smallest volcano is found in Mexico, called Cuexcomate. It is located on the outskirts of Puebla City and has a height of just 43 feet.
- Thlachihualtepetl, or the Great Pyramid of Cholula in Mexico, is known as the world’s largest pyramid by volume known to ever exist. You can look for customisable Mexico trip packages where you can add this site.
- The first printing press in North America was set up in modern-day Mexico City by Juan Cromberger in 1539.
- Mexico is home to jaguars, with an estimated population of around four to five thousand of them living in the wild.
- The capital city of Mexico is slowly sinking. Built on a lake, Mexico City has sunken a total of 30 feet over the years, at a rate of 20 inches per year.
Mexico culture
Here are some popular culture habits and traditions followed in Mexico;
- Mexicans love to hold fiestas, where they celebrate various occasions like birthdays, anniversaries, weddings, etc., in a grand manner. Laughter, dance and music, good food and decorations are some of its major features.
- Mexico celebrates a special event called Dia del Nino on 30th April, where children receive presents and candies from their parents and teachers. Fiestas, games, competitions, etc., are held at schools instead of classes.
- To honour the ones who have died, Mexican families observe the famous Dia de los Muertos on November 1st and 2nd. Calaveras, marigold flowers, home altars (Ofrendas), visiting graves with gifts, etc., are some highlights of this event. Consider Mexico trip packages around this time to witness this popular event.
Mexico visa for Indians
In order to enter Mexico for the purpose of tourism, Indian nationals will need to acquire a Mexico tourist visa. This visa allows a stay of up to 180 days in the country, and you must apply for it prior to your travel. Do note that some Mexico trip packages may or may not include visas. However, you can easily get a visa for your Mexico trip yourself through the online visa services offered by Thomas Cook. Just visit the official site, enter the country name, visa type and preferred branch and submit your communication details to get a quote. You can then proceed to pay online through any popular medium (credit card, debit card, net banking, etc.), submit necessary documents online or at a nearby branch and receive your visa without any hassle.
Foreign currency for Mexico visit
The official currency of Mexico is the Mexican Peso (Code: MXN). The approximate value of 1 Mexican Peso to Indian Rupee is 1 MXN = 4.82 INR. You will need to acquire sufficient Mexican pesos for your Mexico trip so you can make payments there without any hassle. You can get foreign exchange through the online forex services offered by Thomas Cook in just a few clicks. Just visit the official website, select the check rate (cash or forex card ), pick the currency type and forex amount, fill in the required traveller details and delivery type, complete the online payment and you will soon receive the forex order completion receipt.
Refine Search:
Must Include Places
Departure City
Price Per Person
Approx price per person
Month of Travel
Package Type
- ( 1 ? 'N':'N' --> ) →
- Optional Flights
Sightseeing
Tour manager, 0 --> rs. 0 --> rs. 0 --> rs. rs. 0) --> % off.
Starting price per adult
Final EMI value will be displayed post the total package cost is calculated
Above points are approximate & calculated for Silver tier members, actual points will be credited basis your membership, after your travel is completed.
- Silver Member - 1%*Total value ( Net )
- Gold Member - 1.5%*Total value ( Net )
For more information, click here
Round trip Flights included
flight optional.
- 1 ? $data.noOfNights+' nights':$data.noOfNights +' night' --> 1 night
All About Mexico
Trending india destinations, trending international destinations, mexico packages from city.
Click on destination labels to get refined search.
- 1 ? $data.noOfNights+' nights':$data.noOfNights +' night' -->
Get the Best Holiday Planned by Experts!
Enter your contact details and we will plan the best holiday suiting all your requirements.
I hereby accept the Privacy Policy and I authorise Thomas Cook Group Companies to contact me.
Maximum Limit Exceeded!
You can select max 3 packages to compare
I want to holiday in
Tell us what you need? & Let your Holiday expert design package for you.
Expedia Rewards is now One Key™
Dubai Vacations & Trips from $1,270
Book a hotel + flight or car together to unlock savings.
- Things to do
I only need accommodations for part of my trip
- payments icon Better together Save up to $580 when you book a flight and hotel together*
- lob hotels icon Find the right fit With over 300,000 hotels worldwide, it's easy to create a perfect package
- lob packages icon Rest easy Plan, book, and manage your trip all in one place
Your Dubai Vacation
For a glitzy, glamorous vacation package deals, Dubai it is. This glossy desert oasis is the perfect stopover en route to Asia and an incredible destination all on its own. Start building your perfect vacation package to Dubai by choosing a luxurious hotel in the city—maybe a spot on The Palm or high in the iconic Burj al Arab, or a resort along Jumeirah Beach. Each one has activities galore: dune buggying in the desert, shopping in the Gold Souk, or dancing at a rooftop bar—and that’s just scratching the surface.
Top destinations in Dubai
The Latest Dubai Vacation Packages
One&Only The Palm
Reviewed on Feb 23, 2024
Address Beach Resort
Reviewed on Mar 20, 2024
FIVE Palm Jumeirah Dubai
Reviewed on Jan 23, 2024
Beach Walk Boutique
Reviewed on Jan 17, 2024
Meliá Desert Palm Member of Meliá Collection
Reviewed on Nov 27, 2023
Where to stay in Dubai
Palm Jumeirah
Discover an archipelago of artificial islands featuring recently opened destinations like The Pointe, Club Vista Mare, and Nakheel Mall. Enjoy various hotels, resorts, and hotel residences, while exploring retail and dining options, all connected by the Palm Jumeirah Monorail.
Downtown Dubai
Home to iconic landmarks like Burj Khalifa and The Dubai Mall, this mixed-use complex offers luxury shopping, an Olympic-size ice rink, and a variety of dining options along Sheikh Mohammad bin Rashid Boulevard.
Dubai Marina
Artificial canal city boasting the world's largest human-made marina, featuring Dubai Marina Mall with 140 retail outlets, and The Walk at JBR for dining. Enjoy Marina Promenade views and access Al Sufouh Tramway for easy transport.
Jumeirah Beach Residence
Waterfront community in Dubai Marina, Jumeirah Beach Residence boasts 40 towers, The Beach retail complex, and a 1.7-km strip called The Walk. Enjoy views of Ain Dubai on Bluewaters Island and easy access to Dubai Marina, Dubai Tram, and Dubai Metro.
Historically significant, this district boasts centuries-old gold and spice souqs, ancient forts, and iconic structures. Shop at City Centre Deira mall, explore the Waterfront Market, or take a boat across Dubai Creek.
Dubai Essential Information
Prepare for your dubai vacation with our essential travel info, dubai hotel deals.
Reviewed on Mar 22, 2024
Reviewed on Mar 24, 2024
Reviewed on Mar 25, 2024
Explore other types of vacation packages
All Inclusive Vacations
Beach Vacations
Kid Friendly Vacations
Golf Vacations
Luxury Vacations
Romantic Vacations
Ski Vacations
LGBTQ Friendly Vacations
Adventure Vacations
Frequently asked questions, discover the most popular places to visit in dubai, burj khalifa.
The tallest man-made structure on earth is a city in the sky that houses luxury apartments, offices and a hotel.
Browse, shop, play and dine at one of the largest shopping and entertainment malls in the world.
Marina Beach
Nothing says vacation like spending a lazy day at Marina Beach, a popular beach in Dubai. Stroll along the marina or attend a sporting event in this family-friendly area.
What to do in Dubai
Dubai: desert safari with bbq dinner & quad biking options, dubai: desert safari with vip bbq and optional quad bike, atlantis dubai: aquaventure waterpark & lost chambers aquarium combo ticket, other vacations you might like.
- Top cities in Dubai
- Vacations and getaways similar to Dubai
- Expedia's Latest Trends
- Hatta Vacations
- Murqquab Vacations
- Al Awir Vacations
- Abu Dhabi Vacations
- Fujairah Vacations
- Ajman Vacations
- Umm al-Quwain Vacations
Additional information about Expedia Group
- 360VirtualTour
- Switzerland
- Experience Slovakia
- Mosco St. Petersburg
- Baltic State
- Netherlands
- Luang Prabang
- Sierra Leone
- Exotic Trip to Tunisia
- Exp. A Peaceful 1 Day Tour
- Backwoods Of Central Highlands
Central America
- Dubai Tour Packages From Kuwait
North America
Gulf countries.
- Exp The Magic Of Madagascar
- Madagascar Combo East-west Tour
- Explore Madagascar’s North
Ticket Booking
- Charter Flights
- Rail Tickets
- Sport Events
Travel Packages
- Leisure Packages
- Cruise Packages
- Visa Services
- Travel Insurance
- Air Ambulance
- Become A Partner
- ENQUIRE NOW
- +965 22095002
MINI YUCATAN EXPERIENCE
2 DAYS / 1 NIGHT
"EXPLORE ANCIENT WONDERS IN ENCHANTING YUCATAN PARADISE"
DAY 1: CANCUN - UXMAL - MERIDA
Embark on a captivating journey from Cancun to the ancient Mayan city of Uxmal, whose name "three times built" speaks to its remarkable history. As the former capital of the Xiu Kingdom, Uxmal served as a center of power and influence in the region during the Classic period. Marvel at the exquisite Puuc-style architecture, including the Quadrangle of the Nuns, the Ball Court, and the Pyramid of the Soothsayer, which soars an impressive 35 meters high. This excellent site has been recognized by UNESCO as a World Heritage Site and is a must-see for anyone interested in Mayan culture.
Following the tour, we'll journey to the enchanting city of Mérida, founded in 1542 on the ruins of the ancient Mayan city of T'Hó. Admire the city's elegant buildings, such as the Centre Montejo, the Cathedral of San Ildefonso, and the Government Palace, all located around the vibrant Plaza Grande. Take a scenic ride along the renowned Paseo de Montejo, where you'll spot stunning landmarks such as the Twin Houses, the Canton Palace, and the Monument to the Homeland. Upon arriving at the hotel, you'll have ample free time to explore Mérida's rich culture and history at your leisure.
DAY 2: MERIDA - IZAMAL - CHICHEN ITZA - CANCUN
Prepare to embark on a remarkable adventure as we depart from the hotel and head towards the awe-inspiring "Yellow City" of Izamal. Be amazed by the historic centre’s beauty, where the imposing San Antonio de Padua Convent stands out. This impressive structure boasts 75 arches and an area of 7,806.43 square meters, making it the second-largest closed atrium in the world. Built by Franciscan missionaries between 1549 and 1561 on the remains of the Pop-Hol-Chac pyramid, the convent is surrounded by the Plaza Zamná, also known as the Plaza del Mercado, the Municipal Palace, and several pyramids, including Tu'Ul, Habuk, Itzamatúl, and Kinich Kakmó, with the latter being the largest in the Yucatán peninsula.
But that's not all! After exploring Izamal, we'll venture toward one of the main archaeological sites of the Mayan World, the religious capital of the Itzaes - Chichén Itzá. Experience the peak of Mayan civilization during the Early Postclassic period at this iconic site, whose name means "the mouth of the well of the water sorcerers." In 1988, UNESCO declared it a World Cultural Heritage Site, and it's not hard to see why. Our tour will begin at the Castillo or Temple of Kukulcan, renowned for the mesmerizing play of light and shadow that occurs on its main staircase during the spring and autumn equinoxes, as well as the winter and summer solstices. This impressive building, recognized as one of the New Seven Wonders of the Modern World, is just the beginning. We'll also visit the Sacred Cenote and other major constructions, including the Ball Court, the Observatory, the Plaza of the Thousand Columns, and the Temple of the Warriors, among others.
At the end of this unforgettable adventure, we'll return to Cancun, where you'll be dropped off at your hotel. Don't miss out on this incredible opportunity to witness the history and grandeur of the Mayan World.
******END OF TOUR******
- 2 meals and breakfast.
- 1-night lodging in Merida.
- Transportation in tourist units.
- Certified Spanish/English speaking guide on board.
- Entrance fee to the archaeological sites.
- Buffet lunch, and drinks are not included.
- Overnight in Merida.
- Drinks during the tour and lunch.
- Personal expenses.
- Entrance fees to sites not mentioned in the program.
- Tips or gratuities to the operator and guide.
Other Destinations
A Top-Notch Travel Service Provider headquartered in Kuwait and offering excellent travel packages for International flights. Enjoy professional customer service, as our dedicated team works with a mission to help you enjoy flying high, be safe and fulfill your travel dreams.
For queries contact:
- [email protected]
IATA No: 42227990
- Customer Support
- Terms of Use
- Privacy Policy
© 2022 Flyworld - All rights reserved.
Inquiry form, career form.
- Why Fly World
- Becoma A Partner
- Sports Event
Tourism Packages
- Leisure Package
- Cruise Package
Quarantine Packages
- Airport Cabs
- Hotel Booking
WHERE WE FLY
Flights from Mexico City (MEX) to Dubai (DXB)
- Where we fly
- The Middle East
- United Arab Emirates
- Flights from Mexico City to Dubai
Search for flights
- Flights from Mexico City to Barcelona
- Flights from Mexico City to Istanbul Airport
- Flights from Mexico City to Phuket
- Flights from Mexico City to Cairo
- Flights from Mexico City to Delhi
- Flights from Mexico City to Bangkok
- Flights from Mexico City to Tel Aviv
- Flights from Mexico City to Moscow
- Flights from Mexico City to Johannesburg
- Flights from Mexico City to Singapore
- Flights from Mexico City to Mumbai
- Flights to Dubai
- Flights to Barcelona
- Flights to Bangkok
- Flights to Cairo
- Flights to Delhi
- Flights to Tel Aviv
- Flights to Mumbai
- Flights to Guangzhou
- Flights to Johannesburg
- Flights to Hong Kong
- Flights to Jakarta
- Flights to Singapore
- South Africa
- United States of America
- Bali Packages
- Saudi Arabia
- Switzerland
- United Kingdom
- Himachal Pradesh
- Jammu and Kashmir
- Maharashtra
- Uttar Pradesh
- New Zealand
Culture and Heritage
- Testimonials
Dubai Holiday Sale Live!
Save upto 20% on Dubai Tour Packages.
Want a memorable holiday?
Talk to our experts to get the best advice and options for your holiday
Dubai Bestsellers including Flights
Dubai Jain Tour
Best Of Dubai - Winter Special
Dubai Extravaganza with Abu Dh...
Dubai 4N, Abu Dhabi 2N
Dubai Shopping Festival 2024
The tripfactory difference.
We have more than 250+ routes on a daily basis where we have the best deals.
We have handpicked hotels in destinations to create the finest experiences
Your trip expert can plan every last detail and make sure everything is just right.
We hand hold while you travel with a 24x7 concierge where you can get assistance round the clock.
Our offices are present in 20+ countries worldwide where we enable you with exceptional deals and quality service
More than 5,00,000+ happy travellers have traveled with us on vacations in the last 6 years.
Best Dubai Family Tour Packages
Wonderful Dubai Gateway
Super saver dubai package.
Best of Dubai
Dubai winter special 5 nights, best dubai shopping trips.
Marcopolo Dubai Deal
Shopping Madness in Dubai
Dubai Fun and Shopping
Enjoy Dubai with Abu Dhabi
Dubai 4N, Abu Dhabi 1N
Dubai & Abu Dhabi Special
Beautiful Yas Island and Dubai
Abu Dhabi 1N, Dubai 3N
Dubai, Atlantis and Yas Island
Experience Lapita with Abu Dha...
Dubai 4N, Dubai 1N, Abu Dhabi 1N
Dubai 5 Star Experiences
Dubai VIP Experience
Private Dubai Experience with ...
Dubai in Style
Best of Dubai with Atlantis
Dubai 4N, Dubai (Palm Islands) 1N
FREQUENTLY ASKED QUESTIONS
HEAR FROM OUR CUSTOMERS
Reviews from Google
Surendra nath, rahuj gandhi, rana sharma, dubai travel guide.
Welcome to Dubai: Your Ultimate Travel Guide Discover the wonders of Dubai, a dynamic and cosmopolitan city that combines modernity with rich cultural heritage. Explore breathtaking architecture, indulge in luxury shopping, and immerse yourself in an unparalleled entertainment scene. Here's everything you need to know to make your Dubai experience unforgettable: Unforgettable Attractions: Soar to new heights at the iconic Burj Khalifa, the tallest building in the world, and savor breathtaking panoramic views from its observation deck. Embark on a shopping extravaganza at The Dubai Mall, home to hundreds of designer stores, entertainment options, and the mesmerizing Dubai Aquarium and Underwater Zoo. Experience the man-made wonder of Palm Jumeirah, an exclusive island renowned for its luxurious resorts, upscale residences, and awe-inspiring vistas. Stroll along the glamorous Dubai Marina, where you can savor waterfront dining, embark on a scenic boat tour, or simply admire the stunning city skyline. Enchanting Cultural Experiences: Step back in time at the Al Fahidi Historic District, also known as the Bastakiya Quarter, and immerse yourself in traditional architecture, art galleries, and the captivating Dubai Museum housed in Al Fahidi Fort. Connect with Emirati culture at the Sheikh Mohammed Centre for Cultural Understanding, where engaging conversations and authentic meals with locals will deepen your appreciation for the traditions and customs of Dubai. Unleash your inner explorer at the vibrant spice and gold souks in the old part of the city, where you can haggle for aromatic spices, exquisite jewelry, and unique handicrafts.
40,000+ customers to Dubai
More than 40,000+ customers have traveled to Dubai
Best in class service
We offer best in class services on the ground with more than 25 people team in Dubai
Best Airfare Deals
Book your Dubai holiday with best airfares in your tour packages
Customized Packages
Talk to our Dubai specialists to get your holiday planned
IMAGES
COMMENTS
Our All-inclusive Mexico Tour Packages from Dubai is the best and cheapest way to explore Mexico and other places with your loved ones. Our Mexico special vacation package includes return air tickets, hotel accommodation, transfers, tours, etc. Go Kite is the trusted tour operator for Mexico Tour Packages from UAE for your loved ones.
Riviera Maya. 120 km stretch of Caribbean coastline between Playa del Carmen and Tulum, on Mexico's north-eastern Yucatán Peninsula. It offer its visitors, wonderful fine white sandy beaches, turquoise waters, archaeological sites, picturesque little towns, recreation centres, freshwater lagoons, underwater caves and cenotes, as well as ecological, and food and lodging options ranging from ...
Mexico Vacation, Trip & Tour Packages. Mexico is the 14th largest country in the area in the world, has 10,000 kilometres/6000 miles of coastline and is ethnically made up of a mixture of Spanish and Indigenous peoples. Historically, it has grown from a melting pot of 300 years of many cultures including the Spanish Conquistadores and the ...
Find the best 10 day tours to Mexico with TourRadar. Choose from 68 tours with 202 real tour reviews. Book now and save with TourRadar.com! ... 10 Best Mexico Vacation Packages 2024/2025 (with Reviews) International Versions. Deutsch: 10 Tage Mexiko Rundreisen; Français: Circuits Mexique de 10 Jours;
Tips for finding Dubai package deals. There are loads of types of vacations in Dubai and the cost will depend on what type of trip you're taking and for how long you'd like to stay. Here are the latest prices for a 3 night trip for 2 travelers: Top vacation $666; Family vacation $593; Romantic vacation $805; Luxury vacation $759; Budget ...
Mexico Tours & Vacation Packages 2024/2025 Save up to 40% on Mexico Tours & Vacation Packages 2024/2025 Mexico Travel Guide. Home. North America. Mexico; Mexico is home to beautiful cities, beaches, food, and ruins. Plus, there is so much rich culture in Mexico, no matter where you look. If you're lucky enough to be visiting Mexico on a tour ...
Mexico Tours & Trips. As famous for ancient Mayan and Aztec ruins as it is for its tequila, tacos and laid back way of life, Mexico is a fascinating mix of cosmopolitan cities and native villages. ... 10 Best Mexico Vacation Packages 2024/2025 (with Reviews) International Versions. English: Mexico Tours & Trips; Deutsch: Mexiko Rundreisen ...
Mexico Travel Guide Mexico Hotels Vacation Rentals in Mexico Mexico Flights Car Rentals in Mexico. Mexico Vacations & Trips from $799 ... With over 300,000 hotels worldwide, it's easy to create a perfect package. lob packages icon. Rest easy. Plan, book, and manage your trip all in one place.
Mexico Tour Packages; Mexico. Mexico Akbar Holidays - Akbar Holidays Packages ... Dubai To Kannur Flight Booking Dubai To Cochin Flight Booking Dubai To Mangalore Flight Booking Dubai To London Flight Booking Dubai To Manila Flight Booking Dubai To Jeddah Flight Booking Dubai To Chennai Flight Booking Dubai To Mumbai Flight Booking Dubai To ...
Bueno, Bonito & Barato: What I learned on Intrepid's Mexico food tour 13 Apr 2023. 10 awesome places to go for your 21st birthday 01 Mar 2023. 9 ways to make meaningful cultural connections through food in 2023 02 Jan 2023. Finding Mexico's hidden gems on a Tailor-Made tour with Fat Girls Traveling ...
Find the right fully guided tour for you in Mexico. There are 168 trips to choose from, that range from one day in length, up to 22 days. The month with the most departures is October, making it the most popular time to visit Mexico. ... 168 Fully Guided tour packages in Mexico with 778 reviews Save and compare this adventure. View Map ...
Find all the holiday packages of Mexico featured here on this portal. Our Mexico vacation packages offer comfortable stay at Mexico hotels, sightseeing and fun-filled activities. Meals. Accommodation. Rs. 93,140. Per Person on twin sharing. Earn eCash. Rs. 2,794.
Mexico Holiday Packages. One of the hottest destinations in the world, Mexico is known for its Caribbean coastline, secret island escapes, booze heritage and Tacos. This biodiverse destination is an obvious choice for travelers looking for some beach fun, trip from desert to jungle and delectable food options. Compare. Categories.
Mexico Holiday Packages - Book Mexico Tour Packages at best price with Akbar Travels. Get Mexico Holiday packages for Family, Couples & Friends from Delhi, Mumbai, Bangalore, Hyderabad, Chennai, Kolkata and anywhere across India at best prices. Book your Mexico Tour Package today!
Rs. 3 50 218. Mexican Fiesta. 8 Nights/ 9 Days. Rs. 2 48 100. Grand Bargain Tour of America with Mexico. 19 Nights/ 20 Days. Rs. 5 06 905. Mexico Tour Packages: Thomas Cook offers Mexico Tour Packages starting at ₹ 2,48,100 only. Book 8N/9D Mexico trip packages with hotels, flights, sightseeing, foods & more.
These are the best deals and discounts on activities and attractions in Mexico City: Mexico City: Teotihuacan, Guadalupe Shrine & Tlatelolco Tour. Mexico City: Xochimilco Boat Tour with Lunch and Drinks. Mexico: Full-Day Teotihuacan & Basilica Guadalupe Tour. From Mexico City: Puebla, Cholula and Tonantzintla Day Trip.
One&Only The Palm. Palm Jumeirah. $3,905. $2,795. per person. Bundle your Dubai flight + hotel & save up to 100% off your flight with Expedia. FREE cancellation on select hotels .
A Top-Notch Travel Service Provider headquartered in Kuwait and offering excellent travel packages for International flights. Enjoy professional customer service, as our dedicated team works with a mission to help you enjoy flying high, be safe and fulfill your travel dreams. For queries contact:
1 stop. from AED 3,324. Mexico City.AED 3,388 per passenger.Departing Sat, Feb 1, returning Fri, Feb 28.Round-trip flight with British Airways.Outbound indirect flight with British Airways, departing from Dubai on Sat, Feb 1, arriving in Mexico City Juarez International.Inbound indirect flight with British Airways, departing from Mexico City ...
Book flights from Dubai to Mexico City and enjoy our world-class service, award ... updates Check your flight status Accessible travel with Emirates Special assistance and requests Travel requirements for Dubai Travel requirements by destination Your ticket options Request a refund Travel safety during COVID-19 Booking with Emirates Our network ...
Departure Date. Duration. 7 nights 3 nights 4 nights 7 nights 9 nights 10 nights 11 nights 14 nights. Rooms & Guests. Search. Call us on 0203 451 2688 or visit one of our expert Travel Advisors find your nearest TUI Store. To top.
Fly Emirates to Mexico City Airport (MEX) and beyond. Get inspired by our recommended destinations and book your next flight or holiday today. And on your way, enjoy superior comfort, gourmet meals and award-winning entertainment with us, whether you're flying in Economy Class, Premium Economy, Business Class or First Class. Flights to Dubai.
Experience the man-made wonder of Palm Jumeirah, an exclusive island renowned for its luxurious resorts, upscale residences, and awe-inspiring vistas. Stroll along the glamorous Dubai Marina, where you can savor waterfront dining, embark on a scenic boat tour, or simply admire the stunning city skyline. Enchanting Cultural Experiences: Step ...