bal travel omra 2023

Join us as we journey together to the most blessed lands of Makkah and Madinah, completing the rites of Umrah, cleansing our souls of accumulated sins and nourishing our hearts with heightened faith. If you’re after an enjoyable, faith- elevating, inspiration-filled trip that promises to deliver an unmatched Umrah experience then choose one of our exclusive packages below:

Safeguarding Your Health on Your Journey is our Priority

Temperature checks will be taken before trips for your safety.

Wearing masks on your journey helps keep everyone safe.

We’re committed to facilitating physical distancing.

All guests and staff are to adhere to sanitizing procedures at all times.

We’re adhering to best practices for cleanliness and disinfection. 

After years of facing towards this great city in each and every prayer and learning about the magnificent history of this most blessed place on Earth, you can now finally pray in front of the first house built and dedicated for the worship of Allah – the Ka’bah. You’ll hear, live, the glorious call to prayer from the famous muadhins, calling ‘Allahu Akbar, Allaaaahu Akbar’ as the sound of the adhaan echoes from the speakers and moves your soul and elevates your imaan. As you join the rows, lines straight and hearts upright, seeking to draw closer to Allah, standing before Him in humility and prayer, you realise, Allah has chosen you to be His Guest in this great journey of faith.

Join us as we relive some of the most defining moments in the history of Islam. Experience the DST difference with our immersive historical tour of Makkah delivered by expert guides that will transport you a prophetic era.

A moving and inspiring story of seclusion and revelation, of prophethood and perseverance, it all starts with a trip to Jabal al Noor, the Mountain of Light, where the Prophet (ﷺ) first received revelation.

Learn about the persecution faced by early Muslims and how they were driven out of Makkah whilst holding firmly onto their faith. Learn about the migration of the Prophet (ﷺ) and the remarkable occurrences at Jabal Thawr that instilled within the believers lessons of tawakkul, of absolute, unwavering reliance in Allah SWT.

Visit the iconic Jabal Ar-Rahmah, the Mount of Mercy, whereupon the Prophet (ﷺ) delivered his famous last sermon and the site which forms the pinnacle of the rites of Hajj. Journey through Mina, the city of tents, where pilgrims follow the example of the Prophet and stay for several days during the Hajj and pelt the three Jamarat, symbolic of warding off the devil and rooted in the story of Ibrahim (عَلَيْهِ ٱلسَّلَامُ).

For the ultimate experience, join us for our unique and exclusive ‘Walking Tour of AlMasjid AlHaram’, where we recount some of the most notable moments and places, delivered by our renowned expert guides.

An immersive experience of the history of Makkah like never before.

Madinah is known and loved for the tranquillity that it brings to our hearts – that feeling that we have finally made it back home – home is definitely where the heart is and our hearts are profoundly connected with a deep love of the Prophet Muhammad (ﷺ) and his beautiful city. It is city that is filled with stories of love and sacrifice, of prophetic wisdom and illustrious companionship. Madinah is a city that keeps on giving – rich in history and lessons that build our faith and traditions and inspire us to become the best versions of ourselves. Welcome home, welcome to Madinah.

Travel back in time with us as we go back some 1400 years and relive some of the most significant moments in the life of the Prophet Muhammad (ﷺ) and his companions. Exclusive to DST, a unique and immersive experience that will leave you longing for more.

From the very first masjid built in Madinah, which the Prophet (ﷺ) himself help construct, Masjid Quba, to Masjid Qiblatain – the masjid of two qiblahs – where the companions prayed in two directions as the qiblah changed from Masjid Al Aqsa in Jerusalem to Masjid Al Haram in Makkah. Be prepared to be in awe of the rich history and insights gained from this tour.

You may be tempted to unsheathe your sword as we recount the epic Battle of Uhud where over seventy companions were killed, live and on site. You’ll get to ascend the archers mount as well as visit and pray for the Martyrs of Uhud.

For the ultimate experience, join us for our exclusive ‘Walking Tour of the Prophet’s Masjid’, where we recount some of the most notable moments in what was then the entire city of Madinah, delivered by our renowned expert guides.

An immersive experience of the history of Madinah like never before.

All Umrah packages are subject to travel mandates, restrictions and regulations and may change at any time. These are not only limited to entrance into KSA from specific countries, proof of vaccination, COVID-19 rules and regulations, limitations on occupancy in hotels, limitations to dining in restaurants, limitations on movement within Saudi Arabia, limitations on entering Haram and limitations on performing more than one umrah, limitations on age, etc.

Choose Your Package

Want to Sponsor a Umrah?

Making the journey to Allah’s House is a lifelong dream for all Muslims, and once we make the journey our hearts yearn to return back again and again. So many of us have been blessed by Allah (swt) to be able to visit His House and fulfill this dream not only once but numerous times. However, there are many brothers and sisters in our communities that are unable to make the journey due to financial hardships. Their desire to visit the two Holy Mosques is a dream of a lifetime and just as strong.

Why not help to fulfill someone’s lifelong dream to visit Madinah and Makkah by performing this act of sadaqah of sponsoring an Umrah pilgrimage.

The process is very simple. We have a list of screened applicants that qualify based on need. We take different factors into account such age, finances, health conditions, etc. and qualify each candidate.

You can earn the reward of sadaqah for making someone dream of performing Umrah a reality and also reap the blessings of their prayers made on your behalf.

Umrah with one of our Partners

Performing umrah with one of our valued partners.

Dar El Salam Travel has been providing exceptional Umrah services for the past three decades using a variety of scholars, organizations, and individuals. We receive exceptional reviews for the religious services, worry free travel, and instruction that we provide during your Umrah journey. Many of the largest Islamic institutions and well known scholars from all over the globe partner with Dar El Salam Travel to provide to you the best in terms of logistical and religious services. They have placed their trust in us due to our years of dedicated commitment to impeccable customer service. We value our partnership with these organizations and individuals as we deliver on our commitment to provide you the most memorable and spiritual journey. Whether its your first time or your return trip, you will be sure to encounter new experiences and expand your Islamic knowledge with our valued partners.

Qalam Spring Break Umrah

COMING SOON

AlMaghrib Institute

4 Nights Madinah: Shahd Hotel 4 Nights Makkah: Fairmont Clock Tower

Fly from JFK  via Saudi Airlines November 17 – November 26

Umrah with AE

5 Nights Madinah:  Movenpick Hotel (Breakfast Included) 5 Nights Makkah : Hyatt Regency Hotel (Breakfast Included)

Land Only Package Dates: October 5 – October 15

Thanksgiving Packages

Thanksgiving umrah package c.

4 Nights Madinah : Crowne Plaza Hotel (Breakfast Included) 4 Nights Makkah : Address Jabal Omar Hotel (Breakfast Included)

Available Dates:

November 16 – November 25 (LAX)

November 16 – November 25 (SEA)

November 16 – November 25 (JFK)

Thanksgiving Umrah Package B

4 Nights Madinah : Movenpick Hotel (Breakfast Included) 4 Nights Makkah : Swissotel Hotel (Breakfast Included)

November 17 – November 26 (IAH or DFW)

3 Holy Cities Packages

3 Nights Madinah: Hilton Hotel (Breakfast Included) 3 Nights Makkah : Fairmont or Jumeirah Hotel (Breakfast Included) 4 Nights Jerusalem: Legacy Hotel (Breakfast Included)

November 21 – December 2 (JFK)

Umrah with Istanbul

3 Nights Madinah: Hilton Hotel (Breakfast Included) 4 Nights Makkah : Fairmont or Jumeirah Hotel (Breakfast Included) 3 Nights Istanbul  Legacy Hotel (Breakfast Included)

November 18 – November 29 (JFK)

10 Night Umrah Trip

November 16 – november 27.

Air & Land Package from JFK on Saudi Airlines

Madinah :  Crowne Plaza Hotel |  Makkah : Hyatt Regency or Jumeirah Hotel

The Saudi Experience

Jeddah:  Assila Hotel  |  Al Ula :  Shaden  Hotel 

Madinah :  Hilton Hotel  |  Makkah : Hyatt Regency Hotel

Thanksgiving Umrah Package A

4 Nights Madinah : Dar Al Taqwa Hotel (Breakfast Included) 4 Nights Makkah : Fairmont Hotel (Breakfast Included)

November 17 – November 26 (IAD) – SOLD OUT

Inclusions/Exclusions

PRICE INCLUDES:

Roundtrip International Airfare (For Air & Land Packages) Accommodations in Madinah Accommodations in Makkah Daily open buffet breakfast at Hotels Ground Transport to Hotels and Airports Haramain train/Bus transfer from Madinah to Makkah Guided Tour of Madinah – Mazarat Guided Tour of Makkah – Mazarat Virtual information session prior to departure Umrah Lecture and Khatirahs on-site Tourist Visa processing and visa fees and Saudi health insurance

EXCLUSIONS:

Lunch & Dinners Cost of PCR test on return Cost of Saudi Sim card (if applicable) Optional Tours Umrah Visa Fee *In case of any quarantine due to COVID all expenses are not included for any days

Winter Packages

Multiple dates, dec 16 - 25: package a.

Madinah : Hilton   | Makkah: Fairmont

LAX via Saudi Airlines

LAND ONLY PACKAGE

Madinah Arrival Date: December 17

Jeddah Departure Date: December 25

Dec 17 - 26: Package A

Fly from IAD via Saudi Airlines

Madinah Arrival Date: December 18

Jeddah Departure Date: December 26

Dec 21 - 30: Package A

Madinah Arrival Date: December 22

Jeddah Departure Date: December 30

Dec 22 - 31: Package A

Madinah Arrival Date: December 23

Jeddah Departure Date: December 31

Dec 23 - Jan 1: Package A

Madinah : Dar Al Taqwa   | Makkah: Hyatt Regency

Fly from JFK via Saudi Airlines

Dec 24 - 31: 7 Nights in Jerusalem

Jerusalem : Golden Walls Hotel

Arrival Date: December 24

Departure Date: December 31

Dec 28 - Jan 6: Package A

Madinah : Hilton| Makkah: Fairmont

JFK via Saudi Airlines

Dec 30 - Jan 13: Umrah with Istanbul Tour

Madinah : Dar Al Taqwa   | Makkah: Fairmont | Istanbul : Crowne Plaza

Air & Land Package from JFK on Turkish Airlines

Arrival Date to IST: December 31

Arrival Date to Madinah: January 4

Departure Date from Jeddah: January 13

3 Holy Cities - Inclusions/Exclusions

4 Nights Accommodations in Madinah 4 Nights Accommodations in Makkah 4 Nights Accommodations in Aqsa Daily open buffet breakfast at Hotels Ground Transport to Hotels and Airports Haramain train/Bus transfer from Madinah to Makkah Guided Tour of Madinah – Mazarat Guided Tour of Makkah – Mazarat Guided Tours of Jerusalem Virtual information session prior to departure Umrah Lecture and Khatirahs on-site Tourist visa processing and visa fees and Saudi health insurance

Two Pickups from TLV Airport:

First pickup at 12 noon Second pickup at 6pm

Two Drop-offs at the Airport:

First drop-off at 4AM Second drop-off at 12 noon

For any additional individuals, separate transfer charges will apply:

From TLV Airport to Hotel: $165 per car (up to 3 to 4 passengers based on luggage)

From Hotel to TLV Airport: $165 per car (up to 3 to 4 passengers based on luggage)

Arrival to Madinah: $75 per car (up to 3 to 4 passengers based on luggage)

Departure from Makkah: $125 per car (up to 3 to 4 passengers based on luggage)

Lunch & Dinners Cost of PCR test on return (if applicable) Cost of Saudi Sim card (if applicable) Optional Tours Umrah visa fees Israel Visa fee (if applicable)

*In case of any quarantine due to COVID all expenses are not included for any days

Dec 16 - 25: Package B

Madinah : Movenpick   | Makkah:  Swiss

Dec 17 - 26: Package B

Madinah : Movenpick   | Makkah: Swiss Maqam

Dec 21 - 30: Package B

Madinah : Movenpick   | Makkah: Swiss Makkah

Dec 18 - 30: 3 Holy Cities

Madinah : Movenpick   | Makkah: Swissotel | Aqsa : Golden Walls

Arrival Date to TLV: December 18

Arrival Date to Madinah: December 22

Departure Date from Jeddah: December 30

Dec 22 - 31: Package B

Inclusions & exclusions.

Roundtrip International Airfare 4 Nights Accommodations in Madinah 4 Nights Accommodations in Makkah Daily open buffet breakfast at Hotels Ground Transport to Hotels and Airports Haramain train/Bus transfer from Madinah to Makkah Guided Tour of Madinah – Mazarat Guided Tour of Makkah – Mazarat Virtual information session prior to departure Umrah Lecture and Khatirahs on-site Tourist visa processing and visa fees and Saudi health insurance

Lunch & Dinners Cost of PCR test on return (if applicable) Cost of Saudi Sim card (if applicable) Optional Tours Umrah visa fees

Sister Led Umrah Packages

Umrah led by ustadha yasmin mogahed, travel dates: january 20 – january 28, roundtrip international flight not included, ustadha yasmin mogahed.

Madinah :   Movenpick Hotel | Makkah : Fairmont Clock Tower

Arrival Date January 20 – Departure Date January 28, 2024

4 Nights in Madinah 4 Nights in Makkah Daily open buffet breakfast at Hotels Ground Transport to Hotels and Airports Haramain train/Bus transfer from Madinah to Makkah Guided Tour of Madinah – Mazarat Guided Tour of Makkah – Mazarat Virtual information session prior to departure Umrah Lecture and Khatirahs on-site Visa processing and visa fees and Saudi health insurance

Lunch & Dinners Cost of Saudi Sim card (if applicable) Optional Tours Umrah Visa fees

I’m deeply thankful for all your kindness in assisting and guiding through this journey. May Allah bless you and all your loved ones with the best in this world and the next Ameen JAK.

Columbus, OH

Thank you Dar El Salam for everything you have been amazing in every way and may Allah bless you and jazakom Allah Khairan .

Los Angeles, CA

For more information please contact us at (866)327-7252

Item added to your cart

Umrah package 2023-2024.

• DEPARTURE DATES & FLIGHT
• ACCOMMODATION
• UMRAH COURSE

ECONOMY CLASS WITH TAX

MEALS INCLUDED

SAUDIA ARLINES

Departure Dates 2023

15-25 MAR (Past Departure)

APRIL (UMRAH RAMADAN)

12-26 APR (Past Departure)

MAY (UMRAH SYAWAL)

10-20 MAY (Past Departure)

20 to 31 July (Past Departure)

2 to 12 August Awal Makkah | 11 Days

(Past Departure)

21 to 30 August Awal Madinah | 10 Days

6 to 16 September Awal Makkah | 11 Days Revival of Faith with Ustazah Liyana Musfirah All Ladies Group Umrah

6 to 16 September Awal Makkah | 11 Days Seerah Umrah with Ustaz Zulkiflee Bachik

25 September to 4 October Awal Makkah | 10 Days

FULLY BOOKED

15 to 25 November Awal Makkah | 11 Days

29 November to 9 December Awal Makkah | 11 Days

29 November to 11 December Awal Makkah | 13 Days

13 to 23 December Awal Makkah | 11 Days

18 to 29 December Awal Makkah | 12 Days

18 to 30 December Awal Makkah | 13 Days

23 December to 3 January 2024 Awal Makkah | 12 Days

Departure Dates 2024

17 to 27 January Awal Makkah | 11 Days

22 to 31 January Awal Makkah | 10 Days

7 to 17 February Awal Makkah | 11 Days

19 February to 04 March (Umrah + Turkiye) Awal Makkah | 15 Days

MARCH (UMRAH RAMADAN)

1 to 11 March Awal Madinah | 11 Days

SELLING FAST

9 to 18 March (Awal Ramadan) Awal Madinah | 10 Days

27 March to 10 April (Akhir Ramadan) Awal Madinah | 15 Days

1 to 11 May (Awal Syawal) Awal Makkah | 11 Days

Package Inclusive of

Optional Tours

Karva Travel & Tours provides optional tours with an additional cost such as Taif City Tour, Jabal Magnet & King Fahd Glorious Quran Printing Complex, Al-Wahyu Museum, Jabal Al Nour (Gua Hira) and many more!

5-Star Accommodation

5 STAR HOTEL

1 MIN WALK TO MASJID

INTERNATIONAL BUFFET

WIFI ACCESS

MAKKAH HOTEL & TOWERS

Overlooking the Holy Haram Mosque and the Kaaba, the Makkah Hotel is set in the heart of Makkah Saudi which is located infront of Masjidil Haram. Experience the extensive onsite shopping mall with 450 brand shops and a food court. Makkah attractions on the doorstep of the Makkah Hotel including the Kaaba and the ZamZam Well.

The Oberoi, Madina is naturally the destination of your choice. It enjoys an unrivalled position just steps away from the Prophet's Mosque, and offers unforgettable views of the mosque’s green dome and the canopied courtyards of pilgrims at prayer.

Umrah Course

Umrah course will be conducted at Karva Travel & Tours, 1 month before date of departure.

Complimentary Perks

Book with us today to enjoy these complimentary * perks from us

TAIF CITY DAY TOUR

LUNCH IN TAIF CITY

CABLE CAR RIDE

*Terms & Condition: Promo & Itinerary are subject to change without any notice.

• Choosing a selection results in a full page refresh.

MY WISH LIST

Wish list and compare.

Do you want to add products to your personal account?

• +1 (718) 848-1222
• [email protected]

Best and Affordable Umrah Packages USA 2024

JFK (1st May - 11th May)

Makkah first.

May 2024 Platinum Umrah Package JFK

JFK (19th April - 28th April)

April 2024 platinum umrah package jfk, tx (24 feb - 04 mar), madinah first, february 2024 nicsa umrah package texas.

JFK (15 Feb - 25 Feb)

February 2024 Platinum (2) Umrah Package JFK

MIA (14 Feb - 24 Feb)

February 2024 umrah package mia.

JFK (14 Feb - 24 Feb)

February 2024 platinum (1) umrah package jfk.

LAX( Dec 30 - Jan 08)

December/ january 2024 platinum lax umrah package.

JFK (Dec 26 - Jan 4)

December 2023 platinum (2) jfk umrah package.

JFK (Dec 24 - Jan 2)

December 2023 Platinum (1) JFK Umrah Package

JFK (Dec 21 - Dec 31)

December 2023 ruby (1) jfk umrah package.

DC (Dec 20 - Dec 29)

December 2023 platinum iad umrah package, jfk (dec 19 - dec 28), december 2023 platinum (3) jfk umrah package.

JFK (Nov 22 - Dec 2)

November 2023 platinum (3) umrah package.

JFK (Nov 20 - 30)

November 2023 platinum (2) umrah package, jfk (nov 15 - nov 25), november 2023 platinum (1) umrah package.

JFK (Nov 22 - Dec 02)

November 2023 ruby umrah package.

November 2023 – Gold Umrah Package

DC (Nov 15 - Dec 02)

November 2023 platinum (4) iad– umrah package, why choose our umrah packages.

Sara International Travel’s objective is to serve Muslims across the globe who intend to perform Umrah and visit the Kaaba and Madinah Al-Munawwarah, the holiest places in the world for Muslims. We have designed the Best Affordable Umrah Packages 2024 from the USA, UK, Trinidad & Tobago, Guyana, Uzbekistan, and Turkey, after a lot of experience, study, and research on what an Umrah pilgrim expects in his dream journey to visit the Kaaba and perform the rituals of umrah with a pure heart.

The Best in Class service and Top quality standards of our Umrah Packages are ideal for someone planning his first Umrah. Our Packages offer the best-in-class food and 5-star Hotels in Makkah and Madinah within close distances to cater to the best Umrah services; we have partnered with 5-star hotels for the best accommodation and airlines to fulfil your needs.

With 30 years of expertise, Sara International Travel offers various choices from Affordable Packages from USA 2024 within your budget and comfort.

Pilgrims can choose to travel for Best Umrah Packages from almost every part of the WORLD, Especially in:

• New York and Other Gates
• Washington DC and Other Gates
• Los Angeles San Francisco

Our Umrah Packages Include:

• Educational training and books will be provided before the Umrah pilgrim
• Personalized ID Badges
• Daily Breakfast during Umrah
• 5-Star Hotels in Makkah & Madinah
• Visit Islamic Sites in Makkah & Madinah
• Group escorted by a Qualified Guide

Sara International Travel (USA) is an Authorized and IATA-Accredited Hajj & Umrah Agency with the best and affordable hajj and umrah packages, founded in 1994 with the blessing of Allah SWT. 

Quick Links

• Umrah Packages 2024
• Umrah 2024 Registration
• Umrah Essentials
• Privacy Policy
• Cookie Policy
• Booking Terms and Conditions

Umrah Guide 2023: Best Time, Visa, Accommodation, Essentials And More

Among the two significant pilgrimages undertaken by Muslims, Umrah is often referred to as the minor journey. Featuring short and simple rituals, it cleanses the mind, body, and soul of the pilgrims. Though Umrah is not obligatory, performing the pilgrimage at least once in a lifetime is highly recommended by the believers of the Islam. The journey needs planning and prepping, and this blog is the Umrah guide you need to plan it well.

What is Umrah?

Umrah or the minor pilgrimage is a pilgrimage to the holy city of Makkah. Muslims from around the world take on this journey to renew their faith in Islam and Allah. Unlike Hajj Umrah is not obligatory but makes an essential part of Islam.

Umrah requirements 2023

Here are the essential requirements to take on the Umrah journey:

1. Valid passport

Pilgrims are required to carry valid passport to Saudi Arabia for at least 6 months before embarking on the journey.

2. Umrah age requirements

There are no specific age requirements for performing Umrah. However, it is generally recommended that individuals be physically and mentally capable of performing the necessary rituals. Children are allowed to perform Umrah with their parents or guardians. However, it is important to ensure that children are able to tolerate the physical demands of the journey and the rituals, such as walking long distances and standing for extended periods of time. Elderly individuals or those with medical conditions should consult with their doctor before undertaking the journey and performing the rituals. They should also take any necessary medications with them and be prepared to adjust their activities and pace accordingly.

3. Umrah visa

One must obtain an Umrah visa, which can only be obtained through an authorized travel agency. The visa application process usually requires a passport-sized photo, a valid passport, and proof of vaccination against certain diseases.

4. Umrah vaccine requirements

Pilgrims are required to produce vaccinations against many deadly diseases such as chicken pox. Further in the lights of COVID-19, pilgrims will also need vaccination certificate for the same.

5. Round-trip ticket

Pilgrims must have a confirmed round-trip ticket, with a specific date of departure from Saudi Arabia.

6. Accommodation

Pilgrims must have a confirmed reservation for accommodation in Makkah and Madinah for the duration of your stay.

Best time to do Umrah

The journey of Umrah is not time-sensitive, but December and January are the popular months when many Muslims prefer to travel to Makkah. This is because of two reasons – one, it is the end of the Hajj season, and two because the weather during months is pleasant in Makkah. As a result, hotel bookings are also easier. Other months preferred by Muslims to go for Umrah include the first and second months of the Islamic calendar, that is Muharram and Safar. Since the Islamic calendar is 10 to 12 days shorter than the solar calendar, these months do not fall on the same date every year but this year the month of Muharram will begin on 9th or 10th August.

How to reach Makkah for Umrah?

Nearest airport : King Abdulaziz International Airport (IATA: JED) in Jeddah

From the airport : Cab is the most preferred mode of transport from the Jeddah airport to Makkah city.

Intercity Travel : Tourists can choose to see the city by bus or taxi. You can also rent a car. However, there are a lot of religious places around the mosque that are at walking distance.

The kingdom of Saudi Arabia issues a special visa for Umrah pilgrims that is valid for 30 days from the date of issue. To apply for the same, pilgrims need to approach the authorized travel agencies. They need to fill in an online application form and submit the NOC certificate from their employees and a letter proving their religion, amongst other things. Besides authorized agencies, government-approved agents are also responsible for looking after pilgrims’ travel and lodging arrangements and can be contacted for the same.

Rituals of Umrah

Umrah brings peace and earns pilgrims many rewards in this life and the life hereafter. It consists of four rituals that Muslims need to perform in order to complete the journey. The first step is Ihram when the pilgrims enter the state of purity and devotion after performing Ghusl and donning Ihram garments. Next, they perform Tawaf around the Kaaba, circling it seven times counter-clockwise. In the third step – Sai, pilgrims walk between the hills of Safa and Marwa while reciting supplications. Lastly, the pilgrims shave their heads and officially complete the pilgrimage.

Must Read: 3 Important Umrah Rituals For Muslim Pilgrims Visiting Makkah

Umrah guide for females

For women performing Umrah, there are some special rules and guidelines that they need to observe during the pilgrimage. These rituals are mainly established to avoid attention so that everyone appears equal before Allah. One of these rules is that the female pilgrims should not wear any kind of makeup during Umrah. They must not wear a headdress that covers their forehead. Also, females must not undertake Umrah during their menstruation cycle.

Must Read: How To Perform Umrah For Women?

Accommodation near the Grand Mosque

Countless people visit the holy Kaaba every year to pay their respects to Allah. The city is home to several accommodation options including luxurious 5 star properties, as well as standard budget hotels.

Top 5-star properties near al-Haram mosque : Park Inn By Radisson Makkah Aziziyah, Pullman ZamZam Makkah, Millennium Makkah Al Naseem, and Hyatt Regency Makkah Hotel

Good Budget Stays near the Kaaba, Makkah : Dana Al Taj, Wisam Al Taj Hotel, Malak Ajyad Hotel, and Jawad Al Taj Hotel

Ziyarat Guide for Makkah

Performing ziyarat means visiting a holy place or a tomb or a shrine. In the holy city of Makkah, there are many religious sites that one must visit while they are visiting Makkah for the purpose of performing Umrah. The city is home to several beautiful mosques like Aisha Mosque where the beloved wife of Prophet Muhammad (PBUH) prepared for entering Ihram and Quba Mosque, which is the second-largest mosque in the city of Makkah and the first mosque in the history of Islam. Other important sites include Jabal Al Nour, where the Prophet Muhammad (PBUH) received his first revelation and Jabal Al Thawr, where the Prophet took refuge to escape from the Quraysh tribe.

Umrah Guide of Essentials

Before undertaking the holy pilgrimage of Umrah, it is better to plan meticulously in order to avoid any issues later. Pilgrims visiting Makkah should carefully research and book their flight tickets in order to avoid any inconvenience. They should pack according to the weather and the key Umrah rituals. In order to help pilgrims in avoiding any mistakes, here is a checklist for intending Umrah pilgrims .

Umrah Guide 2023 FAQs

What is the best time to perform umrah.

The pilgrimage of Umrah is not time-dependent, yet December and January are the preferred months when numerous Muslims like to head out to Makkah. This is because of two main reasons: primarily it is the end of the Hajj season, and secondly because the weather during these months is pleasant in Makkah which makes it easier for the pilgrims to come to perform the rituals.

The nearest airport to Makkah is the King Abdulaziz International Airport in Jeddah. From the airport to Makkah city, cabs are the most preferred mode of transport as the airport is just 97.7 km away from the city. Moreover, tourists can choose to reach the city by bus.

Why do pilgrims walk around the Kaaba seven times?

During Hajj, pilgrims should circulate around it seven times in counterclockwise direction to guarantee that the Kaaba stays on their left side. The circumnavigating is known to demonstrate the unity and solidarity of the believers in the love of the one true God, Allah.

What is the Ziyarat Guide for Makkah?

Performing Ziyarat implies visiting a sacred spot or a tomb or a shrine. In the holy city of Makkah, there are many religious sites that one must visit while he/she is visiting the city for the purpose of performing Umrah.

Can you drink water during tawaf?

Tawaf should be finished in one go, and the pilgrims ought not to leave until every one of the seven rounds is finished. When the seven rounds are finished, the pilgrims should remain in Masjid Al-Haram and supplicate two rakats. After that, they must drink water from the Zamzam while reciting the dua.

How much does Umrah cost from India?

Embarking on the journey will cost you around INR 40,000 to INR 1,50,000.

What is the difference between Umrah and Hajj?

Hajj is a mandatory journey that every Muslim have to take once in their lifetime. Whereas Umrah is non-obligatory. Further, Hajj can only be done at a particular time in the year, while Umrah can be done at any time of the year.

How many days are required to complete Umrah?

Generally, one would require around 3 to 7 days to complete the journey for a memorable experience.

Dr Omar Ayoub

Dr. Omar Ayoub is a tech enthusiast and a part time researcher and accounts authorship of several international publications. He holds a PhD in Computer Science from USA and has an experience of more than 10 years in Saudi Arabia working in tourism, hospitality, education, technology and retail sector. His interests include traveling, writing, and exploring trending technologies.

Related Posts

Restrictions Lifted As Umrah Pilgrims Can Travel Across Saudi Arabia

Zamzam Al Birr MoU Aims To Develop Al Birr’s IT Infrastructure

Authorities Will Accept Schengen Visa For Umrah in Saudi Arabia

Umrah E Visa Process Now Simplified With Digital Visa App

Leave a reply, we use cookies.

Zamzam.com uses cookies for proper & secured functioning of the site, and personalizing its content & advertising to ensure a superior user experience. Know more.

Information for Travellers During COVID-19

• 2 doses of Pfizer BioNTech
• 2 doses of Oxford AstraZeneca
• 2 doses of Moderna
• 1 dose of Johnson and Johnson
• A visitor must enter their immunization data into the Saudi vaccination registration system “Muqeem” before arrival into Saudi Arabia. The vaccination registration website address is: https://muqeem.sa/#/vaccine-registration/home .
• Visitors arriving in Saudi Arabia are also required to provide a negative PCR COVID-19 test taken no more than 72 hours before departure and an approved paper vaccination certificate, issued by the official health authorities in the issuing country.
• Visitors are advised to check the current entry requirements with their chosen airline before purchasing a ticket.

+1 (214) 689-8139

• [email protected]

All Umrah Packages

Group umrah packages, halal tours.

Umrah International

4 star premium umrah packages.

4 Star Deluxe Umrah Package

5 Days  |   $595 Per Person

4 Star Premium Umrah Package

7 Days  |   $690 Per Person

10 Days  |   $790 Per Person

Get 4 Star Premium and Deluxe Umrah Packages from USA

Umrah is one of the best ways to get Allah’s blessings (SWT). Our main job is to make sure that pilgrims who are going from Umrah to Mecca and Medina feel safe and happy. In the business of Islamic tourism, people know and trust us. Many people in the USA have faith in our travel agency. Before we make offers to people in the USA, we look closely at everything we have done with Umrah. Umrah International has many different Umrah packages, from the cheapest to the most expensive. All of them are made to meet the needs of Muslims in the USA at the best prices.

Our resolute team of  IATA -certified travel advisors have gone through special training and use their past experiences and feedback from customers to create these 4 Star Umrah Packages that have everything you need.

4 Star Umrah Packages by Umrah International

We are proud to make it easier for Muslims to pray by offering a wide range of 4 Star Premium Umrah Packages that include flights, hotels, and easy ground transportation. Explore this range and order the cheapest Umrah packages with full services, a 4 Star Deluxe Umrah Packages USA offer with affordable services, or a 4 star Umrah package with luxury insurance services based on your needs by clicking book now.

Our 4 Star Umrah Packages 2023 will help you find peace, piety, and Allah’s forgiveness for all your sins, big or small. This is the only reason it is known all over the world.

Our  4 Star Premium Umrah Packages from USA  has given many pilgrims memories that will last a lifetime by giving them first-class meals, luxurious accommodations, and easy flights to Saudi Arabia and transportation between Makkah, Madinah, and Jeddah. If you have booked with us before and had a tough time, our 4 Star Economy Umrah Package will make sure that does not happen again. Staying in places close to haram will make your trip more enjoyable.

4 Star Deluxe Umrah Packages are available at Umrah International

It is challenging to travel with others. The peace of mind and success of Umrah for your friends, family, coworkers, and other close people who are traveling together in a group is largely dependent on where they stay and how big their rooms are. Your lodging property must also be a close to the house of Allah and that complimentary shuttle service is also especially important for pilgrims in group to be worship Allah almighty with full vigor.

Umrah in Group

Therefore,Umrah International offers a huge variety of well-catered 4 star Umrah packages ranging from 4-star group umrah packages for 7 persons, affordable 4star Umrah Packages for 10 person groups that want to enjoy blend of affordability with comfort to 4 Star Umrah Packages for 20 persons for ultimate comfort & worry-free traveling.

Why do Muslims in the USA Go To Umrah International for Umrah Packages?

Planning your Umrah trip sounds like a wonderful way to relax and unwind. It fills your heart, body, and soul with Allah Almighty’s blessings, chances, and kindness. You feel more spiritual and start to see the world differently. Umrah is a religious ceremony in Islam that helps people get closer to the religion and ask for forgiveness for their mistakes. The best thing about Umrah is that you can do it any time of the year. This makes life a lot easier for Muslims all over the world. Umrah International is one of the best places in the United States to find the best and cheapest Umrah Packages with airfare. Many Muslims all over the world trust us and believe what we say. When planning your trip, our experienced and professional agents in the United States take care of everything so you can pray.

Hotels and transportation, direct and indirect return flight tickets, after-sale help in any way our clients need it, and more are all part of our carefully planned Umrah deals. Thousands of people in the United States have a good relationship with us because we are honest and trustworthy. They keep coming back and referring more people to us to book new Umrah packages all year long. Before we offer our Umrah passengers in the United States a deal, we think about all of the small things that make a deal work. If you want us to plan your perfect itinerary and set you up on the best Umrah package for 2023, then let us help you out.

Why Should You Book 4 Star Umrah Packages 2023 with Us?

The USA’s most reputable travel company is us. We help pilgrims have a wonderful Umrah journey because we are approved by the Saudi Ministry of Hajj and Umrah and have a lot of experience in this field. Look below to see how we:

Travel Agency for Everything

Hotels, airlines, and even transportation in Saudi Arabia all sell tickets in real time now. Umrah services set up round-trip flights with real tickets and hotels near Haram. In 2023, you will need tickets, a place to stay, and a visa to do Umrah.

Simple Booking:

Our experts on travel can help you set up your  4 star Umrah Packages . They will help you find the best place to stay, pick a direct flight, and plan your Umrah based on your budget for 2023 so that you can easily book for Umrah.

Reservations at the Last Minute

We can offer the best last-minute Packages on Umrah because we have partnerships with hotels and airlines. We can get you tickets on major airlines and good accommodations in 2023. You can count on us to make reservations at the last minute.

We Guarantee The Best Price

Reserve a 4 Star Premium Umrah Package USA that will not break your budget. Our real-time ticketing system and direct connections to the best hotels in Makkah and Medina make  it possible for our Umrah experts to match your budget and desired travel dates for 2023.

Below you will find answers to some frequent questions revolving around our Hajj Umrah Packages, services, quality standards & pricing policies. Every human psyche is different though, so do not hesitate to reach out to us and get answers regarding anything else you might be wondering.

Quick Inquiry Form

Umrah International is one of the world’s leading Hajj and Umrah experts headquartered Houston Tx, USA.

Umrah Packages:

• All Luxury Umrah Packages
• 5 Star Luxury Umrah Packages
• 4 Star Deluxe Umrah Packages
• 3 Star Budget Umrah Packages
• All Group Umrah Packages

Connect With Us:

• (214) 689-8139
• 17350 State Hwy 249 Ste 220 Houston TX 77064 , USA

Copyright © 2023 umrahinternational.com

WhatsApp us

NEW YORK (JFK) UMRAH TOUR

22 January – 30 January

Departure from JFK (New York)

Airfare included via Egypt Airlines from JFK

YOUR STAY IN MADINAH

Madinah Accommodation: January 22 – 26, 2023

• 3 Nights in Zam Zam Pullman Hotel (5 Star)
• Visit to historical sites
• Full transport
• Hotel gallery given below

YOUR STAY IN MAKKAH

Makkah Accommodation: January 26 – 30, 2023

• 4 Nights in Movenpick Hajar Towers or Swissotel Makkah – Clock Towers (5 Star)
• Breakfast Included
• Full transportation

ADDITIONAL SERVICES

• Visa Processing (USA)
• Medical Insurance
• Guidance & Coordination
• Meet & Assist Upon Arrival & Departure
• 24 Hours Assistance Available during the stay

PACKAGE PRICE (PER PERSON)

Non USA, Additional $298.00/Person

Children with no beds, 2 to 11 years old, $1698.00/Child

Infants with no beds, under 2 years old, $898.00/Infant

Interested in this Package?

You can unsubscribe at any time. Please see our Privacy Policy .

COUNTRYPICKERWESELECTEDHEADERMESSAGE

COUNTRYPICKERWESELECTEDMESSAGE click here

Choose your country and language

• The Americas
• The Middle East
• Asia & South Pacific
• All-Inclusive Offers
• Early Booking Offers
• Europe Offers
• Indian Ocean Offers
• Maldives Offers
• Last Minute Holidays
• Luxury Holidays
• Shopping Holidays

Featured Destinations

• Switzerland
• United Kingdom
• Philippines
• South Korea
• South Africa

Australasia

• New Zealand

Indian Ocean

• Czech Republic
• Antigua and Barbuda
• All-Inclusive Holidays
• Beach Holidays
• Business Class
• City Breaks
• Family Holidays
• Romantic Retreats
• Umrah Packages
• Costa Rica Tours
• Europe Tours
• Germany - Landscapes of Germany
• Jordan Tours
• Malaysia Tours
• South Africa Tours
• Sri Lanka Tours
• Tanzania - Best of Selous and Zanzibar
• COVID-19 Hub
• Branch Location & Timings
• Pay My Balance
• Flight + Hotel

Search Holidays

• Manage My Booking

An Unforgettable Umrah

Packages to suit your pilgrimage

Umrah – a long-awaited journey, a lifetime experience. At Emirates Holidays, we understand the importance of making your Umrah pilgrimage as special and sacred as possible, which is why we’ve customized packages just for you.

From hand-picking hotels in Makkah that are within walking distance from Al Masjid Al Haram, to arranging return flights and airport transfers to and from Jeddah, we’ll make sure your holy journey is as seamless and stress-free as possible.

Reach out to one of our experienced travel consultants to plan your perfect journey today.

Limited-time offer

Pullman zamzam grand suites, makkah.

• 4 nights from AED 2,949pp
• Classic Room
• Breakfast included
• Return Emirates flights from Dubai (DXB)
• Additional Skywards Miles
• All taxes and surcharges included

Valid for new bookings only and subject to availability.

Swissotel Al Maqam Makkah

• 4 nights from AED 3,039pp

Hilton Suites Makkah

• 4 nights from AED 3,429pp
• Standard Guest Room City View

Conrad Makkah

• 4 nights from AED 3,569pp
• Superior Room

Jabal Omar Hyatt Regency Makkah

• 4 nights from AED 4,079pp
• Room with King Bed/Twin Beds

Raffles Makkah Palace

• 4 nights from AED 4,299pp
• Signature Suite City View

Join the Emirates Holidays Community

Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.

We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.

Why Emirates Holidays?

• Personalised holidays
• Support at every step
• Get more for your money
• Fly Better with Emirates
• Enjoy rewards with Emirates Skywards

For more information, please click here

• Recent Hotels 0 You do not have any recently viewed hotels.
• Shortlist 0 Your hotel shortlist is empty!
• Recent Searches You do not have any recent searches

Please refresh this page

This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.

• +978 304 7635
• [email protected]

February Packages

$2600.00 / per person, $2800.00 / per person, 5 nights with 5 star in makkah hotel.

3 Nights With 4 Star In swiss international Hotel.

Shawwal Packages

$3000.00 / per person, $2850.00 / per person, $2750.00 / per person, 5 nights with 5 star in swissotel al maqam in mecca..

4 Nights With 5 Star In Hotel Frontel Al Harithia.

September 20th - September 30th

Seats are limited.

Embark on a soul-enriching Umrah journey from February 17th to February 27th.

UMRAH PACKAGES

Umrah visa processing, transport by luxury bus, international air tickets, guidance of imam, travel insurance, 5 star hotel accomodation.

Frequent Asked Questions?

Umrah gallery, february umrah.

INformation

• Cruises/Tours
• Contact us: [email protected]
• Hajj & umrah: [email protected]
• Booking: [email protected]

SUBSCRIBE US

Subscribe to our newsletter and get a discount on your travel.

• Privacy Policy
• Terms & Condition

© 2023 Amerka Travel. Made by: BigWheel IT

Join our UMRAH group and  Experience The Spiritual Journey Of A Lifetime , Under The Guidance Of our religious scholars 

Due to COVID-19 Virus Safeguarding Your Health Is Our Top Priority, With Every Package We Will Be Providing You With a Hygiene Kit Complimentary So You can Stay Safe On your Journey.  

LAST 13 NIGHTS OF RAMADAN

Umrah group, march 27- april 11, 2024, 13 nights package, from san francisco / los angeles, (madinah first).

April 17 - April 27, 2024

8 nights package, from san francisco & los angeles.

May 15 - May 25, 2024

July 18 - July 27, 2024

From los angeles.

AUGUST 2024

August 21 - september 01, 2024, dallas / new york.

 September 11 - September 19, 2024

Economy umrah, 6 nights package.

 September 18 - September 29, 2024

Umrah with istanbul.

October 23 - November 02, 2024

NOVEMBER / DECEMBER / JANUARY

Umrah group coming soon.

2741 Hamner Ave #201, Norco, CA 92860

Email: [email protected]

Tel: 1-855-2-MAKKAH

CUSTOM UMRAH PACKAGE

Thanks for submitting!

A PARTNER OF YOUR HOLY JOURNEY

Journey of a lifetime, experience the sacred journey to the holy land with our trusted travel agency. with 7 years of experience, big umrah travel has provided affordable yet memorable journeys for thousands of clients from all parts of indonesia..

IDR 25,500,000

UMRAH & TURKEY

Idr 26,000,000.

IDR 28,500,000

WHY CHOOSE US

We are committed to helping every servant of Allah who feels called to the Holy Land by offering an affordable tour package

With over 7 years of experience, we have served thousands of Allah's guests from all over Indonesia, earning their trust and loyalty

Customizable

Whether you prefer to choose from our package options or customize your own based on your needs and preferences, we are here to help

Best Services

We take care of everything from preparation to returning home, allowing you to fully focus on your worship

Longer Duration

We offer longer trip durations, from 14 to 30 days. So you have enough time to fully immerse yourself in the Holy Land

Big Umrah Travel is a travel agency dedicated to assisting Muslims who wish to fill their spiritual journey to the Holy Land. Our goal is to make Umrah and Hajj accessible to all Muslims in Indonesia by offering affordable packages. Over the past 7 years, we have served thousands of Allah guest with our exceptional service. Our all-inclusive packages cover everything from pre-trip preparations, flights, accommodation, experienced guides, and more, allowing our customers to fully focus on their worship. We also offer customizable packages to meet specific travel needs and preferences.

Happy Customers

Memorable trips, years of experience, what they say.

"Mbak Lismi, makasi ya buat pendampingannya sebelum, selama, dan sesudah umroh. Semoga jadi ladang pahala buat Mbak Lismi. Buat Uda Hendry dan Mbak Chaca, makasih sudah membuat mimpi kita jadi nyata. Berumroh secara hemat, cermat dan cerdas. Semoga Allah SWT selalu melancarkan Big Umrah Travel"

Rury Mega Octiyavera

"Big Umrah Travel adalah komunitas yang solutif atas niat suci ke Tanah Haromain. Transparansi yang jelas dan tentunya penuh dengan rasa hanat kekeluargaan yang terasa sejuk dan dalam. Insha Allah berkah. Recommended bangetttt. berkahhh."

Janual Aldi

"Mbak Lismi pokoknya makasih banyak. Meskipun pulang malam2 habis umrah masih kuat dan ikhlas nganterin Aka, Ibu, dan saya uber2 cari rumah sakit 24 jam. Buat Pak Hendry dan Mbak Chaca, terima kasih atas umroh mewahnya tapi low budgetnya luar biasa. Semoga menjadi pahala buat Pak Hendry, Mbak Chaca, dan Mbak Lismi. Aamiin

Titi Yulia Riska

"The performers of Hajj and Umrah are deputations of Allah Almighty. If they call Him, He answers them and if they seek His forgiveness, He forgives them."

- Prophet Muhammad (PUBH)

FREQUENTLY ASKED QUESTIONS

Where is the starting point of this trip, the starting point of this trip is jakarta. however, if you prefer to start from your hometown, you can make your own travel arrangements to jeddah, and we can start the trip from there. please contact us for more details.  , can i have a private trip, yes, you can. we offer fully customizable trips tailored to your needs and preferences. contact us to customize your trip according to your preferences.  , can an elderly person who isn't familiar with technology join this trip, absolutely we provide comprehensive assistance throughout the entire journey, starting from trip preparation, guiding them during the trip, and ensuring a safe return to indonesia., does the package include a visa, the inclusion of a visa depends on the specific tour package. some packages do include the visa, while others do not. to find out more about the visa details for each tour package, please check the information provided for that particular package., what if i don't have a passport, our package does not include a passport. however, if you need assistance in obtaining one, we are here to help. we can guide you step-by-step through the passport application process if required., what transportation will be used during the trip is it private or public, the package includes public transportation, such as buses and trains, for the duration of the trip. however, if you prefer a private trip with personalized transportation, we can arrange that for you. contact us to discuss and customize your trip accordingly..

STAY UPDATED ON UPCOMING TRIPS

• ATN members
• Egypt Tours
• Turkey Tour Packages
• Saudi Arabia Tour
• Emirates Dubai Experience
• Travel Insurance
• Umrah Express

Travel ِAnywhere

Adam travel network, atn services, hajj and umrah packages 2022.

JOIN US TODAY AND ACCESS OUR MEMBERS EXCLUSIVE AIRFARES

Adam Travel is one of the nation’s largest consolidators offering a variety of products like hajj and umrah packages and services for all of your travel needs.

In addition to airfares, Adam Travel is a large tour provider offering vacation packages across the globe as well as Hajj and Umrah packages

• You can now customize your program completely online!
• Your flights, transportation, and hotels can all be booked.
• Through our new portal including your Tourist Visa.

HAJJ PACKAGES 2024

Affordable Hajj Packages 2024

• HAJJ PACKAGES PREMIUM & EXPRESS
• HAJJ PACKAGES STANDARD

Hajj and Umrah packages 2024

Umrah packages 2024, september umrah package #1, october package #2, march package #3, ramadan package, our history.

Adam Travel Services began serving customers in 1984 as a single location full-service travel agency. The company founder, Dr. Abdo Ibrahim, immigrated to the United States to further his education at Northeastern University where he earned a Doctorate of Philosophy in Physics. Thereafter, Dr. Ibrahim decided to put his entrepreneurial prowess to work. A frequent traveler himself, Dr. Ibrahim saw opportunities in the travel industry, particularly when it came to serving the needs of the every growing ethnic population in Boston and surrounding areas. His efforts over the last two decades have yielded one of the most respected travel consolidators in the country. In its twenty five years, Adam Travel Services has seen significant growth and expansion. There are currently 30 office locations ready to serve your needs.

Adam Travel

Download Our App

About Adam Travel

Adam Travel Services began serving customers in 1984 as a single-location full-service travel agency.

The company founder, Dr. Abdo Ibrahim, immigrated to the United States to further his education at Northeastern University where he earned a Doctorate of Philosophy in Physics. The company has been in business for over 35 years. Dr. Abdo Ibrahim continues to serve as President and CEO.

Quick Links

7 MARSHALL STREET, BOSTON, MA 02108

Airline Ticketing Support: 1-857-366-7534

HAJJ & UMRAH :1-857-366-7234

Email:[email protected]

Hajj, 2024!

Check our exclusive Hajj packages from Kolkata.

Pre-registeration to give top priority of the available spaces for Hajj 2024.

Search Hajj, Umrah & Holiday Packages for 2023-24

• Holiday Packages
• From Select Location kolkata Patna Delhi NCR Mumbai Hyderabad Bangalore Year Select Year 2024 2025 2026 Package Class Select Package Silver Silver Plus Gold Premium Silver Busy Gold Search
• From Select Location kolkata Patna Delhi NCR Mumbai Hyderabad Bangalore --> On month Select Month January February March April May June July August September October November December Package Class Select Package Gold Silver Search
• From Select Location kolkata Patna Delhi NCR Mumbai Hyderabad Bangalore --> To Select Location Ladakh Darjeeling On month Select Month January February March April May June July August September October November December Search

1.8 million Muslims mark Largest Hajj pilgrimage in history’ in Saudi Arabia

Explore Hajj 2023-24 Best Packages Starting from 645000/pp only

Download 2023-24 hajj form now, explore umrah 2023-24 best packages starting from 89000/pp only, download 2023-24 brochure now, hajj deals 2024, haj silver package - 34-36 days, haj silver economy - 38-40 days, haj silver busy package - 16-17 days, haj gold premium package - 12-14 days, popular destinations, explore umrah 2023-24 packages starting from 89000/pp only, coming soon, our hajj and umrah tours, our selection of hotels in makkah and madina, contact details.

• Address 18, Ustad Enayet Khan Avenue, Karaya Road, Kolkata - 700 017.
• Phone Number +91(33) 2289-0011
• Fax Number +91(33) 2289-0046
• Email Address [email protected]

• Moscow Tourism
• Moscow Hotels
• Moscow Bed and Breakfast
• Moscow Vacation Rentals
• Flights to Moscow
• Things to Do in Moscow
• Moscow Travel Forum
• Moscow Photos
• All Moscow Hotels
• Moscow Hotel Deals
• Things to Do
• Restaurants
• Vacation Rentals
• Travel Stories
• Rental Cars
• Add a Place
• Travel Forum
• Travelers' Choice
• Help Center

Bal Vampirov - Mdm-Hall

• Europe    
• Russia    
• Central Russia    
• Moscow    
• Moscow Restaurants    

Travelers who viewed Mdm-Hall also viewed

Been to mdm-hall share your experiences, owners: what's your side of the story.

Own or manage this property? Claim your listing for free to respond to reviews, update your profile and much more.

Browse nearby

Turn Your Curiosity Into Discovery

Latest facts.

Follistatin344 Peptide Considerations

Approach for Using 5 Tips To Help You Write Your Dissertation

40 facts about elektrostal.

Written by Lanette Mayes

Modified & Updated: 02 Mar 2024

Reviewed by Jessica Corbett

Elektrostal is a vibrant city located in the Moscow Oblast region of Russia. With a rich history, stunning architecture, and a thriving community, Elektrostal is a city that has much to offer. Whether you are a history buff, nature enthusiast, or simply curious about different cultures, Elektrostal is sure to captivate you.

This article will provide you with 40 fascinating facts about Elektrostal, giving you a better understanding of why this city is worth exploring. From its origins as an industrial hub to its modern-day charm, we will delve into the various aspects that make Elektrostal a unique and must-visit destination.

So, join us as we uncover the hidden treasures of Elektrostal and discover what makes this city a true gem in the heart of Russia.

Key Takeaways:

• Elektrostal, known as the “Motor City of Russia,” is a vibrant and growing city with a rich industrial history, offering diverse cultural experiences and a strong commitment to environmental sustainability.
• With its convenient location near Moscow, Elektrostal provides a picturesque landscape, vibrant nightlife, and a range of recreational activities, making it an ideal destination for residents and visitors alike.

Known as the “Motor City of Russia.”

Elektrostal, a city located in the Moscow Oblast region of Russia, earned the nickname “Motor City” due to its significant involvement in the automotive industry.

Home to the Elektrostal Metallurgical Plant.

Elektrostal is renowned for its metallurgical plant, which has been producing high-quality steel and alloys since its establishment in 1916.

Boasts a rich industrial heritage.

Elektrostal has a long history of industrial development, contributing to the growth and progress of the region.

Founded in 1916.

The city of Elektrostal was founded in 1916 as a result of the construction of the Elektrostal Metallurgical Plant.

Located approximately 50 kilometers east of Moscow.

Elektrostal is situated in close proximity to the Russian capital, making it easily accessible for both residents and visitors.

Known for its vibrant cultural scene.

Elektrostal is home to several cultural institutions, including museums, theaters, and art galleries that showcase the city’s rich artistic heritage.

A popular destination for nature lovers.

Surrounded by picturesque landscapes and forests, Elektrostal offers ample opportunities for outdoor activities such as hiking, camping, and birdwatching.

Hosts the annual Elektrostal City Day celebrations.

Every year, Elektrostal organizes festive events and activities to celebrate its founding, bringing together residents and visitors in a spirit of unity and joy.

Has a population of approximately 160,000 people.

Elektrostal is home to a diverse and vibrant community of around 160,000 residents, contributing to its dynamic atmosphere.

Boasts excellent education facilities.

The city is known for its well-established educational institutions, providing quality education to students of all ages.

A center for scientific research and innovation.

Elektrostal serves as an important hub for scientific research, particularly in the fields of metallurgy, materials science, and engineering.

Surrounded by picturesque lakes.

The city is blessed with numerous beautiful lakes, offering scenic views and recreational opportunities for locals and visitors alike.

Well-connected transportation system.

Elektrostal benefits from an efficient transportation network, including highways, railways, and public transportation options, ensuring convenient travel within and beyond the city.

Famous for its traditional Russian cuisine.

Food enthusiasts can indulge in authentic Russian dishes at numerous restaurants and cafes scattered throughout Elektrostal.

Home to notable architectural landmarks.

Elektrostal boasts impressive architecture, including the Church of the Transfiguration of the Lord and the Elektrostal Palace of Culture.

Offers a wide range of recreational facilities.

Residents and visitors can enjoy various recreational activities, such as sports complexes, swimming pools, and fitness centers, enhancing the overall quality of life.

Provides a high standard of healthcare.

Elektrostal is equipped with modern medical facilities, ensuring residents have access to quality healthcare services.

Home to the Elektrostal History Museum.

The Elektrostal History Museum showcases the city’s fascinating past through exhibitions and displays.

A hub for sports enthusiasts.

Elektrostal is passionate about sports, with numerous stadiums, arenas, and sports clubs offering opportunities for athletes and spectators.

Celebrates diverse cultural festivals.

Throughout the year, Elektrostal hosts a variety of cultural festivals, celebrating different ethnicities, traditions, and art forms.

Electric power played a significant role in its early development.

Elektrostal owes its name and initial growth to the establishment of electric power stations and the utilization of electricity in the industrial sector.

Boasts a thriving economy.

The city’s strong industrial base, coupled with its strategic location near Moscow, has contributed to Elektrostal’s prosperous economic status.

Houses the Elektrostal Drama Theater.

The Elektrostal Drama Theater is a cultural centerpiece, attracting theater enthusiasts from far and wide.

Popular destination for winter sports.

Elektrostal’s proximity to ski resorts and winter sport facilities makes it a favorite destination for skiing, snowboarding, and other winter activities.

Promotes environmental sustainability.

Elektrostal prioritizes environmental protection and sustainability, implementing initiatives to reduce pollution and preserve natural resources.

Home to renowned educational institutions.

Elektrostal is known for its prestigious schools and universities, offering a wide range of academic programs to students.

Committed to cultural preservation.

The city values its cultural heritage and takes active steps to preserve and promote traditional customs, crafts, and arts.

Hosts an annual International Film Festival.

The Elektrostal International Film Festival attracts filmmakers and cinema enthusiasts from around the world, showcasing a diverse range of films.

Encourages entrepreneurship and innovation.

Elektrostal supports aspiring entrepreneurs and fosters a culture of innovation, providing opportunities for startups and business development.

Offers a range of housing options.

Elektrostal provides diverse housing options, including apartments, houses, and residential complexes, catering to different lifestyles and budgets.

Home to notable sports teams.

Elektrostal is proud of its sports legacy, with several successful sports teams competing at regional and national levels.

Boasts a vibrant nightlife scene.

Residents and visitors can enjoy a lively nightlife in Elektrostal, with numerous bars, clubs, and entertainment venues.

Promotes cultural exchange and international relations.

Elektrostal actively engages in international partnerships, cultural exchanges, and diplomatic collaborations to foster global connections.

Surrounded by beautiful nature reserves.

Nearby nature reserves, such as the Barybino Forest and Luchinskoye Lake, offer opportunities for nature enthusiasts to explore and appreciate the region’s biodiversity.

Commemorates historical events.

The city pays tribute to significant historical events through memorials, monuments, and exhibitions, ensuring the preservation of collective memory.

Promotes sports and youth development.

Elektrostal invests in sports infrastructure and programs to encourage youth participation, health, and physical fitness.

Hosts annual cultural and artistic festivals.

Throughout the year, Elektrostal celebrates its cultural diversity through festivals dedicated to music, dance, art, and theater.

Provides a picturesque landscape for photography enthusiasts.

The city’s scenic beauty, architectural landmarks, and natural surroundings make it a paradise for photographers.

Connects to Moscow via a direct train line.

The convenient train connection between Elektrostal and Moscow makes commuting between the two cities effortless.

A city with a bright future.

Elektrostal continues to grow and develop, aiming to become a model city in terms of infrastructure, sustainability, and quality of life for its residents.

In conclusion, Elektrostal is a fascinating city with a rich history and a vibrant present. From its origins as a center of steel production to its modern-day status as a hub for education and industry, Elektrostal has plenty to offer both residents and visitors. With its beautiful parks, cultural attractions, and proximity to Moscow, there is no shortage of things to see and do in this dynamic city. Whether you’re interested in exploring its historical landmarks, enjoying outdoor activities, or immersing yourself in the local culture, Elektrostal has something for everyone. So, next time you find yourself in the Moscow region, don’t miss the opportunity to discover the hidden gems of Elektrostal.

Q: What is the population of Elektrostal?

A: As of the latest data, the population of Elektrostal is approximately XXXX.

Q: How far is Elektrostal from Moscow?

A: Elektrostal is located approximately XX kilometers away from Moscow.

Q: Are there any famous landmarks in Elektrostal?

A: Yes, Elektrostal is home to several notable landmarks, including XXXX and XXXX.

Q: What industries are prominent in Elektrostal?

A: Elektrostal is known for its steel production industry and is also a center for engineering and manufacturing.

Q: Are there any universities or educational institutions in Elektrostal?

A: Yes, Elektrostal is home to XXXX University and several other educational institutions.

Q: What are some popular outdoor activities in Elektrostal?

A: Elektrostal offers several outdoor activities, such as hiking, cycling, and picnicking in its beautiful parks.

Q: Is Elektrostal well-connected in terms of transportation?

A: Yes, Elektrostal has good transportation links, including trains and buses, making it easily accessible from nearby cities.

Q: Are there any annual events or festivals in Elektrostal?

A: Yes, Elektrostal hosts various events and festivals throughout the year, including XXXX and XXXX.

Was this page helpful?

Our commitment to delivering trustworthy and engaging content is at the heart of what we do. Each fact on our site is contributed by real users like you, bringing a wealth of diverse insights and information. To ensure the highest standards of accuracy and reliability, our dedicated editors meticulously review each submission. This process guarantees that the facts we share are not only fascinating but also credible. Trust in our commitment to quality and authenticity as you explore and learn with us.

Share this Fact: